Primary Information |
|---|
| BoMiProt ID | Bomi5489 |
|---|
| Protein Name | Endonuclease/exonuclease/phosphatase family domain-containing protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3MHJ7 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001029581.1 |
|---|
| Aminoacid Length | 571 |
|---|
| Molecular Weight | 62787 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | EEPD1 |
|---|
| Gene ID | 511767 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Regulates ABCA1 Abundance and Cholesterol Efflux |
|---|
| Biochemical Properties | EEPD1 belongs, catalyze cleavage of phosphodiester bonds found in nucleic acids, phospholipids, and perhaps also proteins. Specifically, several members of this family have lipid phosphatase activity, mainly toward inositol phosphates. |
|---|
| Significance in milk | Phosphatase acts on aromatic phosphates, casein,and pyrophosphates (both organic and inorganic). |
|---|
| PTMs | Phosphorylation on Tyr-15 and Ser-159 |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHJ7|EEPD1_BOVIN Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Bos taurus OX=9913 GN=EEPD1 PE=2 SV=1
MGSTLGCHRSIPRDPSDLS*16HS*21RKFS*25AACNFSNILVNQERLNINTATEEELMTLPGVTRAV
ARSIVEYREYIGGFKKVEDLALVSGVGATKLEQVKFEICVSSKGSS*106AQHS*110PSSLRRDLMA
EQQPHHLATAAAVPLTPRVNINTATPAQLMSVRGLTEKMAVS*162IVDYRREHGPFRS*175VEDLV
RMGGINAAFLDRIRHQVFAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLPPGGP
TQIISTRPSVEAFGGTRDGRPVLRLAT*267WNLQGCSVEKANNPGVREVVCMTLLENSIKLLA
VQELLDREALEKFCVELNQPILPNIRKWKGPRGCWKAVVSETPSTQLQKGAGFAGFLWDT
AAGVELRDAAWQESSPGNGHGKPVGPSPYLARFKVGSHDLTLVNLHLATLTLPGGENLSK
NHSDSHRWAS*432FTQTLQETLKGEKDVIVLGDFGQGPDSSDYDILRKEKFHHLIPAHTFTNI
STKNPQGSKALDNIWISKSLKKVFTGHWAVVREGLTNPWIPDNWSWGGVASEHCPVLAEF
YTEKDWTRKEGPRSGNGLTLERSEANIKHER |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Significance of PTMs | Phosphorylation at Tyr-15 by ABL1 and FYN, and at Ser-159 is essential for maximal catalytic activity.By contrast, phosphorylation at Thr-14 inhibits activity. |
|---|
| Additional Comments | Loss of EEPD1 in several cell types facilitates repair of stressed replication forks induced by DNA-damaging chemicals and that it does so by promoting homologous recombination. |
|---|
| Bibliography | 1.Nelson JK, Koenis DS, Scheij S, Cook EC, Moeton M, Santos A, Lobaccaro JA, Baron S, Zelcer N. EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux. Arterioscler Thromb Vasc Biol. 2017 Mar;37(3):423-432. doi: 10.1161/ATVBAHA.116.308434. Epub 2017 Jan 12. PMID: 28082258; PMCID: PMC5321112. 2.Wu Y, Lee S-H, Williamson EA, et al. EEPD1 rescues stressed replication forks and maintains genome stability by promoting end resection and
homologous recombination repair. PLoS Genet. 2015;11:e1005675. |
|---|
