Primary Information |
|---|
| BoMiProt ID | Bomi5388 |
|---|
| Protein Name | E3 ubiquitin-protein transferase MAEA/Macrophage erythroblast attacher |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3MHJ2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029587.1 |
|---|
| Aminoacid Length | 434 |
|---|
| Molecular Weight | 49396 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MAEA |
|---|
| Gene ID | 511956 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells. |
|---|
| Biochemical Properties | RING domain which mediate direct transfer of ubiquitin to the substrate from the E2. RING domains coordinate two Zn2+ ions in a cross braced arrangement critical for its structure, or without Zn2+ coordination in the case of the U-box family of E3 ligases in which case polar and charged residues substitute for the Zn2+ ions. |
|---|
| PTMs | phosphorylation,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHJ2|MAEA_BOVIN E3 ubiquitin-protein transferase MAEA OS=Bos taurus OX=9913 GN=MAEA PE=2 SV=1
MAVQESAAQLSMTLKVQEYPTLKVPYET*28LNKRFRAAQKNIDRETSHVTMVVAELEKTLSG
CPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVW
KRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLA
WCHDNKSRLRKMKGRQSEHDAKTGRKSRVASGSPKESEDLGMETIKGKPELSCLEFSLRI
QEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQVMGMLAFPPDTHISPYKDLLDPAR
WRMLIQQFRYDNYRLHQLGNSSVFTLTLQAGLSAIKTPQCYKEDGSSRSPDCPVCSRSLN
KLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYVYGYNSLLSIRQDDKVVCPRTK
EVFHFSQAEKVYIM |
|---|
| Predicted Disorder Regions | 190-223 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Autoubiquitinated as component of the CTLH E3 ubiquitin-protein ligase complex |
|---|
| Additional Comments | MAEA overexpression in hepatocytes resulted in the reduction of the expression levels of gluconeogenesis genes, glucokinase and HNF-4α. |
|---|
| Bibliography | 1.Maitland MER, Onea G, Chiasson CA, Wang X, Ma J, Moor SE, Barber KR, Lajoie GA, Shaw GS, Schild-Poulter C. The mammalian CTLH complex is an E3 ubiquitin ligase that targets its subunit muskelin for degradation. Sci Rep. 2019 Jul 8;9(1):9864. doi: 10.1038/s41598-019-46279-5. PMID: 31285494; PMCID: PMC6614414. 2.Wei, Q., Pinho, S., Dong, S. et al. MAEA is an E3 ubiquitin ligase promoting autophagy and maintenance of haematopoietic stem cells. Nat Commun 12, 2522 (2021). https://doi.org/10.1038/s41467-021-22749-1 |
|---|
