Primary Information |
|---|
| BoMiProt ID | Bomi5375 |
|---|
| Protein Name | E3 ubiquitin-protein ligase RNF34/RING finger protein 34/RING-type E3 ubiquitin transferase RNF34 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5E9J6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001014858.1 |
|---|
| Aminoacid Length | 375 |
|---|
| Molecular Weight | 41788 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | RNF34 |
|---|
| Gene ID | 506764 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | RNF34 regulates postsynaptic γ2-GABAAR clustering and GABAergic synaptic innervation by interacting with and ubiquitinating the γ2-GABAAR subunit promoting GABAAR degradation. |
|---|
| Biochemical Properties | RNF34 also reduces the expression of the γ2 subunit when α1 and β3 subunits are co-assembled with γ2. This effect is partially reversed by leupeptin or MG132, indicating that both the lysosomal and proteasomal degradation pathways are involved. |
|---|
| PTMs | Phosphorylation at Ser,Autoubiquitinated(Invitro) |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5E9J6|RNF34_BOVIN E3 ubiquitin-protein ligase RNF34 OS=Bos taurus OX=9913 GN=RNF34 PE=2 SV=1
MKAGATSMWASCCGLLNEVMGTGAVRGQQSGFAGGTGPFRFTPNSDFSAYPPASAEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHRLGSEDDLDTSSLNSSRS*169QTSSFFTHSFF
SNYTAPSATASSFQGELMGGDRTLGSGALAQEPSEIASANTEDDEDDDDDDDDDDDDDEE
NLEDRTPGLTKKRVRAS*257LS*259DLSSLEDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVN
RLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECP
ICRQYVVRAVHVFKS |
|---|
| Predicted Disorder Regions | 28-50, 158-169, 186-262, 308-319 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Overexpression of RNF34 in hippocampal neurons decreases the density of γ2 GABAAR clusters and the number of GABAergic contacts that these neurons receive. |
|---|
| Bibliography | 1.Jin H, Chiou TT, Serwanski DR, Miralles CP, Pinal N, De Blas AL. Ring finger protein 34 (RNF34) interacts with and promotes γ-aminobutyric acid type-A receptor degradation via ubiquitination of the γ2 subunit. J Biol Chem. 2014 Oct 17;289(42):29420-36. doi: 10.1074/jbc.M114.603068. Epub 2014 Sep 5. PMID: 25193658; PMCID: PMC4200290. |
|---|
