Primary Information |
---|
BoMiProt ID | Bomi5304 |
---|
Protein Name | Dynactin subunit 6 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q148G7 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001069106.1 |
---|
Aminoacid Length | 190 |
---|
Molecular Weight | 20675 |
---|
FASTA Sequence |
Download |
---|
Gene Name | DCTN6 |
---|
Gene ID | 513751 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | testis |
---|
Protein Function | Dynactin subunit 6 (DCTN6) (a component of the cell dynactin complex), as a specific binding partner for E2,a protein in classical swine fever (CSF) virus (CSFV) is the major virus structural glycoprotein and is an essential component of the viral particle. |
---|
PTMs | Phosphorylation at Thr-186 |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q148G7|DCTN6_BOVIN Dynactin subunit 6 OS=Bos taurus OX=9913 GN=DCTN6 PE=2 SV=1
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDPEPKPMIIGTNNVFEVGCYCQAMKIGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGGDCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSST*186PVKN
|
---|
Predicted Disorder Regions | 1-8, 67-79, 176-190 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Phosphorylation by CDK1 during mitotic prometaphase creates a binding site for PLK1 that facilitates its recruitment to kinetochores. |
---|
Bibliography | 1.Borca MV, Vuono EA, Ramirez-Medina E, Azzinaro P, Berggren KA, Singer M, Rai A, Pruitt S, Silva EB, Velazquez-Salinas L, Carrillo C, Gladue DP. Structural Glycoprotein E2 of Classical Swine Fever Virus Interacts with Host Protein Dynactin Subunit 6 (DCTN6) during the Virus Infectious Cycle. J Virol. 2019 Dec 12;94(1):e01642-19. doi: 10.1128/JVI.01642-19. PMID: 31597779; PMCID: PMC6912105. |