Primary Information |
|---|
| BoMiProt ID | Bomi5304 |
|---|
| Protein Name | Dynactin subunit 6 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q148G7 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001069106.1 |
|---|
| Aminoacid Length | 190 |
|---|
| Molecular Weight | 20675 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DCTN6 |
|---|
| Gene ID | 513751 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | testis |
|---|
| Protein Function | Dynactin subunit 6 (DCTN6) (a component of the cell dynactin complex), as a specific binding partner for E2,a protein in classical swine fever (CSF) virus (CSFV) is the major virus structural glycoprotein and is an essential component of the viral particle. |
|---|
| PTMs | Phosphorylation at Thr-186 |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q148G7|DCTN6_BOVIN Dynactin subunit 6 OS=Bos taurus OX=9913 GN=DCTN6 PE=2 SV=1
MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQA
LIINAHPDNITPDAEDPEPKPMIIGTNNVFEVGCYCQAMKIGDNNVIESKAYVGRNVILT
SGCIIGACCNLNTFEVIPENTVIYGGDCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKT
MKGSST*186PVKN
|
|---|
| Predicted Disorder Regions | 1-8, 67-79, 176-190 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation by CDK1 during mitotic prometaphase creates a binding site for PLK1 that facilitates its recruitment to kinetochores. |
|---|
| Bibliography | 1.Borca MV, Vuono EA, Ramirez-Medina E, Azzinaro P, Berggren KA, Singer M, Rai A, Pruitt S, Silva EB, Velazquez-Salinas L, Carrillo C, Gladue DP. Structural Glycoprotein E2 of Classical Swine Fever Virus Interacts with Host Protein Dynactin Subunit 6 (DCTN6) during the Virus Infectious Cycle. J Virol. 2019 Dec 12;94(1):e01642-19. doi: 10.1128/JVI.01642-19. PMID: 31597779; PMCID: PMC6912105. |
|---|
