Primary Information |
|---|
| BoMiProt ID | Bomi5239 |
|---|
| Protein Name | Docking protein 1/Downstream of tyrosine kinase 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EA84 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001019714.2 |
|---|
| Aminoacid Length | 483 |
|---|
| Molecular Weight | 52206 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DOK1 |
|---|
| Gene ID | 514962 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | acts as a tumor suppressor in breast cancer by inhibitory effect on major oncogenic signaling pathways such as Mek/Erk/PI3k/Akt and Wnt/β-catenin |
|---|
| Biochemical Properties | Full-length(FL) p62 DOK1 has an N-terminal plextrin homology (PH) domain formembrane binding, a phospho-tyrosine-binding (PTB) domain for in-teraction with phospho-tyrosine substrates (e.g.growth factor recep-tors, integrins,etc.)and a C-terminal domain withproline and phospho-tyrosine residues which bind SH3-domains andSRC kinase, respectively |
|---|
| PTMs | Acetylation and phosphorylation on Tyr residue |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA84|DOK1_BOVIN Docking protein 1 OS=Bos taurus OX=9913 GN=DOK1 PE=2 SV=1
MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGS*48SSGGGRGSSRRL
DCKVIRLAECVSVAPVAVESPPEPGAASFRLDTAQRSHLLAADAPSSAAWVQTLCQNAFP
KGSWALAPAENPPKLSALEMLENSLYSPSWEGSQFWVTVQKTEAAERCGLHGSYVLRVEA
ERLTLLAPGAQRQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGND
IFQAVETAIHRQKIQGKAGQGQDVLRADS*269HEGEVADGKLASLAAPLELPGS*291PPALY*296SEPL
DSLRIPPGPSQDSLYSDPLDSTPARAGEGTQLKKALY*337WDLCEHVQQKLIKAKLTDPKEDP
IY*362DEPEGLAPATLRGLY*377DLPQEPKDAWWCQARVKEEGY*398ELPYNPAMDDY*409AVPPPRS*416TKPFPAPKPQGLALSESGAATGSGSQGHSSDTALY*451SQVQKSGASGS*462WDCGLSGVVTDRTGAKSE
GST
|
|---|
| Predicted Disorder Regions | 51-58, 81-84, 267-270, 295-331, 401-418, 430-483 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | inhibit the regulation of the insulin signaling pathway |
|---|
| Additional Comments | DOK1 also triggers apoptosis by recruiting and interacting withSMADs and inhibits expression of inflammato-ry genes driven by NFκBandSTATs in hematopoietic cells |
|---|
| Bibliography | 1.Tuna E, Ersoy YE, Bulut P, Ozdemir F, Buyru N. Analysis of the DOK1 gene in breast cancer. Mol Biol Rep. 2020 Mar;47(3):1605-1612. doi: 10.1007/s11033-020-05247-3. Epub 2020 Jan 9. PMID: 31919752. 2.C.L. Oxley, N.J. Anthis et al.
J. Biol. Chem., 283 (9) (2008), pp. 5420-5426
3.N. Yamakawa, K. Tsuchida et al.
EMBO J., 21 (7) (2002), pp. 1684-1694. 4.C.A. Nold-Petry, C.Y. Lo et al.
Nat. Immunol., 16 (4) (2015), pp. 354-365 |