Primary Information |
|---|
| BoMiProt ID | Bomi5235 |
|---|
| Protein Name | DnaJ homolog subfamily C member 17 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KI83 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039741.1 |
|---|
| Aminoacid Length | 304 |
|---|
| Molecular Weight | 34572 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DNAJC17 |
|---|
| Gene ID | 524795 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Localized to nuclear speckles.heat shock protein (HSP40) family member, recognized essential function in early development.Role in splicing-related processes. |
|---|
| Biochemical Properties | contains a RRM motif |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus OX=9913 GN=DNAJC17 PE=2 SV=1
MAVTKELLQMDLYALLGIEEKAEDKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL
EVLTDAAARAAYDKVRKAKKQAAERTQKLDERRKKVKLDLEARERQAQALGS*112EEEEESGS
ARTLEQEIERLREEGSRQLEEQQRLIREQIRQEQEQRLTGMAKNPENKETPKLKLKWKSK
KEAESQGGYSRDVLLQLFQKYGEVLNLVLSSKKAGTAVVEFATVKAAELAVQNEVGLVDN
PLKISWLEGRPQSAMGHNHPGLSRGSVVSERDYESLVMMRMRQAAERQQLIAQMQQEDQA
GQPT
|
|---|
| Predicted Disorder Regions | 39-52, 77-185, 250-269, 286-304 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Additional Comments | DNAJC17 knockout mouse embryos die prior to implantation.In humans, germline homozygous mutations in DNAJC17 have been found in syndromic retinal dystrophy patients, while heterozygous mutations represent candidate pathogenic events for myeloproliferative disorders. |
|---|
| Bibliography | 1.Pascarella A, Ferrandino G, Credendino SC, Moccia C, D'Angelo F, Miranda B, D'Ambrosio C, Bielli P, Spadaro O, Ceccarelli M, Scaloni A, Sette C, De Felice M, De Vita G, Amendola E. DNAJC17 is localized in nuclear speckles and interacts with splicing machinery components. Sci Rep. 2018 May 17;8(1):7794. doi: 10.1038/s41598-018-26093-1. PMID: 29773831; PMCID: PMC5958099. |