Primary Information |
|---|
| BoMiProt ID | Bomi5183 |
|---|
| Protein Name | DNA helicase MCM8/Minichromosome maintenance 8 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | E1BPX4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001179965.1 |
|---|
| Aminoacid Length | 816 |
|---|
| Molecular Weight | 90768 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MCM8 |
|---|
| Gene ID | 507507 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is involved in the repair of double-stranded DNA breaks (DBSs) and DNA interstrand cross-links (ICLs) by homologous recombination (HR).Also,MCM8 and 9 subunits alternate to form the hetero-hexameric ring and play imp role in replication initiation.MCM8/9 is thought to resume some DNA unwinding to process downstream HR intermediates. |
|---|
| Biochemical Properties | has helicase and ATPase activity.It interacts with MCM9 and participates in homologous recombination repair. winged-helix domain is imp for DNA binding.Also contain AAA+ core domain or ATP binding domain and a winged-helix domain (WHD) in the C-terminal. The canonical architecture of WHD includes three α helices (H1, H2 and H3), three β strands (S1, S2 and S3), and two wings (W1 and W2), in the order of H1–S1–H2–H3–S2–W1–S3–W2 . |
|---|
| PTMs | Phosphorylation on Ser-630,Ubl conjugation on K651. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|E1BPX4|MCM8_BOVIN DNA helicase MCM8 OS=Bos taurus OX=9913 GN=MCM8 PE=3 SV=2
MNGKYRGRGFGQGRFQSWKSGRGGRGFSGKWREREHRPDLNKATGKHPEQTPQSLLLQST
LDHFIPYKGWKLYFSEVYSDSIPFIEKIEAFESFFTERIELYDKDEIERKGSILVDFKEL
INDDEIIKLIPNIANELRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSRNGETV
VNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNTKPLCTKMAFLCAACGEI
QSLSLPDGKYNLPTKCPVPACRGKSFTALRSSPLTVTMDWQSIKIQELMSDDQREAGRIP
RTIECELVHDLVDSCVPGDTVTITGVVKVSNAEEANSVSNNKGQKTKASEDGCKHGALME
FSLKDLYAIQEIQSEENLFKLIVNSLCPVIFGHELVKAGLALALFGGSQKYADDKNRIPI
RGDPHVLVVGDPGLGKSQMLQAVCSVAPRGVYVCGNTTTTSGLTVTLSKDSSSGDFALEA
GALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSISLAKAGMVCSLPARTSIIAAANPVG
GHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVIAIRAGKQRAVSSAT
VARMNS*606QDSNTSILEVVSDKPLSERLKVVPGETIDPIPHQLLRKYIGYSRQYVYPRLSTE
AAQILQNFYLELRKQSQRLSSSPITTRQLESLIRLTEARARLELREEATKEDAEDIVEIM
KYSMLGTYSDEFGNLDFERSQHGSGMSNRSAAKRFISALNKIAERTYNNLFQFHQLQQIA
KELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | ubiquitination on Lys-651 is involved in various cellular processes, such as protein stability, cell-cycle progression, DNA replication, and cellular metabolism.O-GlcNAcylation (O-linked β-N-acetylglucosaminylation) is catalyzed by O-GlcNAc transferase (OGT) on S338, S361, T484, S485, S555, S574, S621, T635, T839 and ensure a rapid response to DNA damage and replication. |
|---|
| Bibliography | 1.Griffin WC, Trakselis MA. The MCM8/9 complex: A recent recruit to the roster of helicases involved in genome maintenance. DNA Repair (Amst). 2019 Apr;76:1-10. doi: 10.1016/j.dnarep.2019.02.003. Epub 2019 Feb 5. PMID: 30743181. 2.Zeng H, Li J, Xu H, Li H, Liu Y. Crystal structure of the winged-helix domain of MCM8. Biochem Biophys Res Commun. 2020 Jun 11;526(4):993-998. doi: 10.1016/j.bbrc.2020.03.150. Epub 2020 Apr 12. PMID: 32295713. 3.Li Z, Xu X. Post-Translational Modifications of the Mini-Chromosome Maintenance Proteins in DNA Replication. Genes (Basel). 2019 Apr 30;10(5):331. doi: 10.3390/genes10050331. PMID: 31052337; PMCID: PMC6563057. |