Primary Information |
---|
BoMiProt ID | Bomi5175 |
---|
Protein Name | DNA damage-binding protein 2/Damage-specific DNA-binding protein 2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q0VBY8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001069256.1 |
---|
Aminoacid Length | 426 |
---|
Molecular Weight | 47591 |
---|
FASTA Sequence |
Download |
---|
Gene Name | DDB2 |
---|
Gene ID | 519357 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | DDB2 acts as a critical regulator of ROS1-mediated active DNA demethylation.DNA damage binding protein 2 (DDB2), a DNA damage-recognition factor, could protect triple-negative breast cancer cells from Poly ADP-ribose polymerase inhibitors (PARPi) by regulating DNA double-strand break repair through the homologous recombination pathway. |
---|
PTMs | Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VBY8|DDB2_BOVIN DNA damage-binding protein 2 OS=Bos taurus OX=9913 GN=DDB2 PE=2 SV=1
MAPRKRPENQKTPEVVVRPKSKRNRS*26PRELEPEAKKLCVKGPGSSRRFDSGLWAGLASLR
VPPLCSSIVRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGMKFNPLNTNQFFTSSMEGTT
RLQDFKGNTLRVFASSDTCNVWFCSLDVSVKSRVVVTGDNVGHVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWLLATASVDQTVKIWDLRQVRGKSSFLHSLPHRHPVNAAHFSPDGA
QLLTTDQKSEIRVYSACQWDCPPSLIPHPHRHFQHLTPIKASWHPRYNLIVVGRYPDPNF
KSCSPHELRTIDVFDGSSGKIMYQLYDPESSGIMSLNEFNPMGDTLASVMGYHILVWSPE
DAGTQK
|
---|
Predicted Disorder Regions | (1-44) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | , DDB2 was reported to regulate the homologous recombination pathway in non‐small cell lung cancer by facilitating the phosphorylation of checkpoint kinase 1 |
---|
Bibliography | 1.Córdoba-Cañero D, Cognat V, Ariza RR, Roldán Arjona T, Molinier J. Dual control of ROS1-mediated active DNA demethylation by DNA damage-binding protein 2 (DDB2). Plant J. 2017 Dec;92(6):1170-1181. doi: 10.1111/tpj.13753. Epub 2017 Nov 27. PMID: 29078035. 2.Zhao L, Si CS, Yu Y, Lu JW, Zhuang Y. Depletion of DNA damage binding protein 2 sensitizes triple-negative breast cancer cells to poly ADP-ribose polymerase inhibition by destabilizing Rad51. Cancer Sci. 2019 Nov;110(11):3543-3552. doi: 10.1111/cas.14201. Epub 2019 Oct 6. PMID: 31541611; PMCID: PMC6825009. |