Primary Information |
---|
BoMiProt ID | Bomi5121 |
---|
Protein Name | Dimethylaniline monooxygenase [N-oxide-forming] 3/Dimethylaniline oxidase 3/Hepatic flavin-containing monooxygenase 3/Trimethylamine monooxygenase |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q8HYJ9 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_776482.1 |
---|
Aminoacid Length | 532 |
---|
Molecular Weight | 60093 |
---|
FASTA Sequence |
Download |
---|
Gene Name | FMO3 |
---|
Gene ID | 281167 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | found in liver |
---|
Protein Function | Essential hepatic enzyme that catalyzes the oxygenation of a wide variety of nitrogen- and sulfur-containing compounds including drugs as well as dietary compounds. catalyzes metabolism of trimethylamine (TMA), via the production of trimethylamine N-oxide (TMAO) metabolite.FMO3 directly impacts both platelet responsiveness and rate of thrombus formation.Defects in FMO3 are the cause of a fishy off-flavor in cow milk due to by an elevated level of trimethylamine (TMA) in body fluids. |
---|
Significance in milk | Low abundance protein in bovine milk.Absence of FMO3 leads to fishy flavour in milk due to increased build-up of TMA, and thus might play an important role in maintaining the quality of milk.The presence of FMO3 at high concentrations in Kashmiri cattle milk can favour utilization of Kashmiri cattle milk in commercial preparations for the promotion of human health and nutritional status. |
---|
PTMs | Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus OX=9913 GN=FMO3 PE=2 SV=1
MVKKVAIIGAGISGLASIRNCLEEGLEPTCFEKGEDIGGLWKFSDHVEEGRASIYRSVFT
NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFQ
TTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGKCFHSRDYKEPG
IFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFE
TFLKNTLPTVISNWWYMKQMNARFKHENYGLMPLNSTLRKEPVFNDELPACILCGIVTIK
PNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPP
LEKPTLAVIGLVQSLGAAIPTTDLQSRWAVQVIKGTCPLPS*401VKDMMNDIDEKMGKKLKLF
GKSDTIQTDYVVYMDELASFIGAKPNIPWLFLTDPKLALEVYFGPCTPYQFRLVGPGKWP
GARNAILTQWDRLLKPMTTRVVGSPLKPCLFCNWFRPVLISVVSIAALIVLF
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | a hepatic microsomal enzyme that oxidizes a host of drugs, xenobiotics and other chemicals. |
---|
Bibliography | Lundén A, Marklund S, Gustafsson V, Andersson L. A nonsense mutation in the FMO3 gene underlies fishy off-flavor in cow's milk. Genome Res. 2002 Dec;12(12):1885-8. doi: 10.1101/gr.240202. PMID: 12466292; PMCID: PMC187563. |