Primary Information |
|---|
| BoMiProt ID | Bomi5099 |
|---|
| Protein Name | Developmentally-regulated GTP-binding protein 1/Neural precursor cell expressed developmentally down-regulated protein 3/TRAFAC GTPase DRG1
NEDD-3/Translation factor GTPase DRG1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3MHP5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029863.1 |
|---|
| Aminoacid Length | 367 |
|---|
| Molecular Weight | 40542 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DRG1 |
|---|
| Gene ID | 540161 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Developmentally regulated GTP-binding protein 1 (DRG1) is a microtubule polymerase that also bundles and stabilizes microtubules.Drg1-Dvl interaction regulates apical actin polymerization and stability in MCCs. Thus, Drg1 is a newly identified partner of Dvl in regulating ciliogenesis. |
|---|
| Biochemical Properties | Developmentally regulated GTP-binding proteins (DRGs) are a deeply conserved group of proteins belonging to the subfamily of Obg GTPases.DRGs are conserved from archaebacterial having one DRG
to eukaryotes from yeast to human, containing DRG1 and DRG2 |
|---|
| PTMs | Acetylation, Hydroxylation at C-3 of Lys-22, Phosphorylated at Thr-100 by STK16, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHP5|DRG1_BOVIN Developmentally-regulated GTP-binding protein 1 OS=Bos taurus OX=9913 GN=DRG1 PE=2 SV=1
MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVA
KTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT*100TVPGVIRYKGAKIQLLDLPG
IIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG
FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVY
IPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKG
QLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED
VIQIVKK
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | DRG1 is highly upregulated in mouse embryonic brain it was suggested to act as a developmental factor9 . However, DRGs are also expressed widely in adult tissue. |
|---|
| Bibliography | 1.Lee M, Hwang YS, Yoon J, Sun J, Harned A, Nagashima K, Daar IO. Developmentally regulated GTP-binding protein 1 modulates ciliogenesis via an interaction with Dishevelled. J Cell Biol. 2019 Aug 5;218(8):2659-2676. doi: 10.1083/jcb.201811147. Epub 2019 Jul 3. PMID: 31270137; PMCID: PMC6683737. 2.Schellhaus AK, Moreno-Andrés D, Chugh M, Yokoyama H, Moschopoulou A, De S, Bono F, Hipp K, Schäffer E, Antonin W. Developmentally Regulated GTP binding protein 1 (DRG1) controls microtubule dynamics. Sci Rep. 2017 Aug 30;7(1):9996. doi: 10.1038/s41598-017-10088-5. PMID: 28855639; PMCID: PMC5577222. |
|---|
