Primary Information |
|---|
| BoMiProt ID | Bomi5088 |
|---|
| Protein Name | Desmin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | O62654 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001075044.1 |
|---|
| Aminoacid Length | 470 |
|---|
| Molecular Weight | 53532 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DES |
|---|
| Gene ID | 280765 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | periphery of Z-disk of striated muscles and at the dense bodies of smooth muscle cells |
|---|
| Protein Function | Muscle-specific type III intermediate filament essential for proper functioning of muscle. |
|---|
| PTMs | phosphorylation, ADP-ribosylation and ubiquitylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O62654|DESM_BOVIN Desmin OS=Bos taurus OX=9913 GN=DES PE=2 SV=3
MSQAYSS*7SQRVS*12SYRRT*17FGGAPSFPLGS*28PLS*31S*32PVFPRAGFGTKGS*45SSSVTSRVYQVSRTS*60GGAGGLGALRASRLGST*77RVPS*81SYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFA
NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAEIYEEELRELRRQVEVLTNQRARVDVER
DNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLK
KVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNIS*290EAEEWYKSKV
SDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFAS*358EA
S*361GYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPI
QTFS*424ALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
|
|---|
| Predicted Disorder Regions | 1-6, 27-35, 425-437, 463-470 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | The major effect of phosphorylation and ADP-ribosylation is the disassembly of desmin filaments, while ubiquitylation of desmin leads to its degradation.ADP-ribosylation of desmin also blocks some PKA phosphorylation.Since serine 51(phosphorylated by PKA) and arginine 49(ADP ribosylated by ARF1) are in close proximity.arginine residues in the head domain are targeted by ADP ribosylation play an important role in stabilizing the filaments.Phosphorylation at Ser-7, Ser-28 and Ser-32 by CDK1 and phosphorylation at Ser-60 by AURKB contribute to efficient separation of desmin intermediate filaments during mitosis. |
|---|
| Bibliography | Winter DL, Paulin D, Mericskay M, Li Z. Posttranslational modifications of desmin and their implication in biological processes and pathologies. Histochem Cell Biol. 2014 Jan;141(1):1-16. doi: 10.1007/s00418-013-1148-z. Epub 2013 Oct 4. PMID: 24091796. |