Primary Information |
|---|
| BoMiProt ID | Bomi5080 |
|---|
| Protein Name | Deoxynucleotidyltransferase terminal-interacting protein 1/Terminal deoxynucleotidyltransferase-interacting factor 1/TdIF1/TdT-interacting factor 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6H7A8 |
|---|
| Milk Fraction | whey |
|---|
| Ref Sequence ID | NP_001092346.1 |
|---|
| Aminoacid Length | 329 |
|---|
| Molecular Weight | 37012 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DNTTIP1/TDIF1 |
|---|
| Gene ID | 505524 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Enhances the DNA polymerase activity.Increases DNTT terminal deoxynucleotidyltransferase activity (in vitro). Also acts as a transcriptional regulator, binding to the consensus sequence 5'-GNTGCATG-3' following an AT-tract. Associates with RAB20 promoter and positively regulates its transcription. |
|---|
| Biochemical Properties | Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and MIDEAS; this complex assembles into a tetramer that contains four copies of each protein chain. |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6H7A8|TDIF1_BOVIN Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Bos taurus OX=9913 GN=DNTTIP1 PE=2 SV=1
MGATGDVEQPRGPGGAERGGPELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSF
TDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRS
CLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECALRGS*162PIPKKRKGRPPGHILANDR
AATGMVWKPKSCEPIRREGPKWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLF
KYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP
SWMVEKMRKYMETLRTENEHRAVEAPPQT
|
|---|
| Predicted Disorder Regions | 1-29, 44-60, 142-205, 317-329 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Additional Comments | DNTTIP1 knockdown (siDNTTIP1) cells showed depressed cellular proliferation by cell-cycle arrest at the G1 phase with high acetylation of p53 and upregulation of p21Cip1.DNTTIP has two isoforms, DNTTIP1 and DNTTIP2. |
|---|
| Bibliography | Sawai, Y., Kasamatsu, A., Nakashima, D., Fushimi, K., Kasama, H., Iyoda, M., Kouzu, Y., Shiiba, M., Tanzawa, H., & Uzawa, K. (2018). Critical role of deoxynucleotidyl transferase terminal interacting protein 1 in oral cancer. Laboratory investigation; a journal of technical methods and pathology, 98(8), 980–988. https://doi.org/10.1038/s41374-018-0070-3 |
|---|
