Primary Information |
|---|
| BoMiProt ID | Bomi5075 |
|---|
| Protein Name | Deoxycytidine kinase/Deoxyadenosine kinase/Deoxyguanosine kinase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3MHR2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029745.1 |
|---|
| Aminoacid Length | 260 |
|---|
| Molecular Weight | 30329 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DCK |
|---|
| Gene ID | 530642 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It plays a pivotal role in the salvage pathway of deoxyribonucleosides for their ultimate conversion to triphosphorylated forms suitable for incorporation into DNA.A nucleoside kinase responsible for the phosphorylation of deoxycytidine (dC), deoxyadenosine (dA) and deoxyguanosine (dG) to their monophosphate form. |
|---|
| Biochemical Properties | either ATP or UTP as phosphoryl donors to catalyze the phosphorylation of nucleoside acceptors. serine 74 is a part of the insert region and is situated distant to the active site. |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3MHR2|DCK_BOVIN Deoxycytidine kinase OS=Bos taurus OX=9913 GN=DCK PE=2 SV=1
MATPPKRSCPS*11PAAS*15SEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELT*72TS*74QKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
|
|---|
| Predicted Disorder Regions | (1-18) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation of serine 74 of human deoxycytidine kinase facilitates it's open conformation making it more competent for nucleoside binding and release. |
|---|
| Bibliography | 1.Hazra, S., Szewczak, A., Ort, S., Konrad, M., & Lavie, A. (2011). Post-translational phosphorylation of serine 74 of human deoxycytidine kinase favors the enzyme adopting the open conformation making it competent for nucleoside binding and release. Biochemistry, 50(14), 2870–2880. https://doi.org/10.1021/bi2001032 |