Primary Information |
---|
BoMiProt ID | Bomi5021 |
---|
Protein Name | Damage-control phosphatase ARMT1/Acidic residue methyltransferase 1/Protein-glutamate O-methyltransferase/Sugar phosphate phosphatase ARMT1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | A3KMX8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001076968.1 |
---|
Aminoacid Length | 441 |
---|
Molecular Weight | 50964 |
---|
FASTA Sequence |
Download |
---|
Gene Name | ARMT1 |
---|
Gene ID | 540698 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | shows phosphatase activity against several substrates andshown to have O-methyltransferase activity that methylates glutamate residues of target proteins to form gamma-glutamyl methyl ester residues. |
---|
Biochemical Properties | The biochemical activities of the human protein are conserved with those of a previously characterized budding yeast homolog, where an in vitro phosphatase activity is supported by divalent cations that include Co2+, Ni2+, Mn2+ or Mg2+. |
---|
PTMs | Acetylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A3KMX8|ARMT1_BOVIN Damage-control phosphatase ARMT1 OS=Bos taurus OX=9913 GN=ARMT1 PE=2 SV=1
MAGPPASLSARDVGSFAYLSVKDRSPQILTKAIDTLHRHKSEFFEKHGEKGLEAEKKAIS
LLSKLRNELQTDKPIVPLVEKFVDTDIWNQYLEYQQSLLNES*102DGKPRWFLSPWLFVECYM
YRRIHEAIIQSPPIDDFDIFKEFKDQNFFESQESIIALCTHLQELRKTIEDLDENQLKNE
FFKVLQISLWGNKCDLSLSGGEHISQKTNIMNSLEDLKPFILVNDMDRLWSLLSNCKKTR
EKESVTRVDIVLDNSGFELITDLVLADFLLSSKLATKIHFYGKTIPWFVSDTTLHDFNWI
IKQLKHSNNKWVSQCGVDWEDHVKTGRWVYLDHIFWTLPHEFSAMSQVAPDLHAALQKAH
LIFFKGDLNYRKLTGDRRWEFTVPFHEALSGFHPAPLCSIRTLKAEVQVGLQPGQGEQLT
ASEPNWLTAGKYGVFQFDGPL
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | The sequence around the two cysteines involved in the redox-active disulphide bond is conserved and can be used as a signature pattern. |
---|
Bibliography | 1.Dennis TN, Kenjić N, Kang AS, Lowenson JD, Kirkwood JS, Clarke SG, Perry JJP. Human ARMT1 structure and substrate specificity indicates that it is a DUF89 family damage-control phosphatase. J Struct Biol. 2020 Oct 1;212(1):107576. doi: 10.1016/j.jsb.2020.107576. Epub 2020 Jul 15. PMID: 32682077. |