Primary Information |
|---|
| BoMiProt ID | Bomi5004 |
|---|
| Protein Name | Cytoskeleton-associated protein 2-like/Radial fiber and mitotic spindle protein/Radmis |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A5PK21 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001092371.1 |
|---|
| Aminoacid Length | 744 |
|---|
| Molecular Weight | 82608 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CKAP2L |
|---|
| Gene ID | 507498 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | for proper mitotic spindle formation and cell cycle progression |
|---|
| Biochemical Properties | 745-amino acid protein has a calculated molecular mass of 84 kD.ontains a KEN degradation motif near the N terminus.D-box and KEN-box- are important for binding to APC/C-cdh1 complex. |
|---|
| Significance in milk | found to be upregulated during early lactational stage |
|---|
| PTMs | phosphorylation .Ubl conjugation by APC/C |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A5PK21|CKP2L_BOVIN Cytoskeleton-associated protein 2-like OS=Bos taurus OX=9913 GN=CKAP2L PE=2 SV=1
MVRPGLSAAAEERQRKLQEYLAAKGKLKCQNTKPYLKAKNNCPNPPHSKSTIGPKKDVTN
HVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQL
RGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEM
NKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPF
VEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKV
NRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQ
TSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSA
PPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKR
PPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEV
FAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQD
RNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPG
IKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVE
ETECFIFRKNEALPVTLGFPVSES*744
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | CKAP2 is phosphorylated on T596 during early phases of mitosis (i.e., prophase, prometaphase, and metaphase), and its de-phosphorylation is initiated at some point during metaphase to anaphase transition.CKAP2 is a physiological substrate of APC/C during mitotic exit and polyubiqitinated by APC/C.The levels of CKAP2 fluctuated across the cell cycle in culture cells, high in mitosis and low during mitotic exit. |
|---|
| Additional Comments | The c.571dupA CKAP2L mutation was associated with the congenital disease Filippi syndrome.CKAP2L mutation is related to defects in the spindle tissue, including mitotic spindle defects, chromosome hysteresis, and other mitotic instability characteristics, that are involved in the formation and development of cancer |
|---|
| Bibliography | 1.Wang P, He X. Oncogenic and prognostic role of CKAP2L in hepatocellular carcinoma. Int J Clin Exp Pathol. 2020 May 1;13(5):923-933. PMID: 32509063; PMCID: PMC7270663. 2.Zhu L, Zheng Y, Hu R, Hu C. CKAP2L, as an Independent Risk Factor, Closely Related to the Prognosis of Glioma. Biomed Res Int. 2021 Sep 28;2021:5486131. doi: 10.1155/2021/5486131. PMID: 34631884; PMCID: PMC8494202. 3.Hong, K., Choi, YB., Lee, JH. et al. Transient phosphorylation of tumor associated microtubule associated protein (TMAP)/cytoskeleton associated protein 2 (CKAP2) at Thr-596 during early phases of mitosis. Exp Mol Med 40, 377–386 (2008). https://doi.org/10.3858/emm.2008.40.4.377 4.Seki A, Fang G. CKAP2 is a spindle-associated protein degraded by APC/C-Cdh1 during mitotic exit. J Biol Chem. 2007 May 18;282(20):15103-13. doi: 10.1074/jbc.M701688200. Epub 2007 Mar 21. PMID: 17376772. |
|---|
