Primary Information | |
|---|---|
| BoMiProt ID | Bomi4986 |
| Protein Name | Cytochrome c oxidase subunit 5A, mitochondrial/Cytochrome c oxidase polypeptide Va |
| Organism | Bos taurus |
| Uniprot ID | P00426 |
| Milk Fraction | Whey |
| Ref Sequence ID | NP_001002891.1 |
| Aminoacid Length | 152 |
| Molecular Weight | 16735 |
| FASTA Sequence | Download |
| Gene Name | COX5A |
| Gene ID | 444878 |
| Protein Existence Status | Reviewed |
Secondary Information | |
| Presence in other biological fluids/tissue/cells | corpus luteum |
| Protein Function | Cytochrome c oxidase subunit 5A (COX5A) is a nuclear-encoded subunit of the terminal oxidase involved in mitochondrial electron transport.COX5A appears to play a key role in modulating the physiological activity of COX and involve in energy metabolism. |
| Biochemical Properties | During the assembly of COX in the mammalian cells, COX1 is first integrated into the inner membrane; this is followed by the formation of the COX4-COX5A heterodimer.COX5A binds indirectly to COX1 via the matrix domain of COX4.COX5A binds specifically to 3, 5-diiodothyronine, abrogating the allosteric ATP inhibition of COX. |
| PTMs | N6-acetylation at Lys,Phosphorylation at Thr |
| Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P00426|COX5A_BOVIN Cytochrome c oxidase subunit 5A, mitochondrial OS=Bos taurus OX=9913 GN=COX5A PE=1 SV=2 MLGAAVRRCSVAAAAVARASPRGLLHPTPAPGQAAAVQSLRCYSHGSHETDEEFDARWVT YFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGP HKEIYPYVIQELRPTLNELGIST*143PEELGLDKV |
| SCOP | Class : All alpha proteins Fold : alpha-alpha superhelix Superfamily : Cytochrome c oxidase subunit E Family : Cytochrome c oxidase subunit E Domain Name : 1V54 E:5-109 |
| CATH | Matched CATH superfamily 1.25.40.40 1.10.8.1230 2.40.180.20 |
| Predicted Disorder Regions | 1-3, 21-34, 146-152 |
| DisProt Annotation | |
| TM Helix Prediction | No TM helices |
| PDB ID | 1OCC, 1OCO, 1OCR, 1OCZ, 1V54, 1V55, 2DYR, 2DYS, 2EIJ, 2EIK, 2EIL, 2EIM, 2EIN, 2OCC, 2Y69, 2YBB, 2ZXW, 3ABK, 3ABL, 3ABM, 3AG1, 3AG2, 3AG3, 3AG4, 3AGN, 3ASO,3WG7, 3X2Q, 5B1A, 5B1B, 5B3S, 5GPN, 5IY5, 5LUF, 5W97, 5WAU, 5X19, 5X1B, 5X1F, 5XDQ, 5XDX, 5XTH, 5XTI, 5Z84, 5Z85, 5Z86, 5ZCO, 5ZCP, 5ZCQ, 6J8M, 6JUW, 6JY3, 6JY4, 6NKN, 6NMF, 6NMP, 7COH, 7CP5, 7D5W, 7D5X, 7EV7, |
| Additional Comments | Abnormal expression of COX5A significantly affects COX function, thereby causing mitochondrial dysfunction in skeletal muscle, pulmonary arterial hypertension, lactic academia, and failure to thrive. |
| Bibliography | 1.Zhang P, Chen Z, Lu D, Wu Y, Fan M, Qian J, Ge J. Overexpression of COX5A protects H9c2 cells against doxorubicin-induced cardiotoxicity. Biochem Biophys Res Commun. 2020 Mar 26;524(1):43-49. doi: 10.1016/j.bbrc.2020.01.013. Epub 2020 Jan 22. PMID: 31980176. 2.Y.Y. Gong, Y.Y. Liu, J. Li, L. Su, S. Yu, X.N. Zhu, X.P. Cao, H.P. Xiao Hypermethylation of Cox5a promoter is associated with mitochondrial dysfunction in skeletal muscle of high fat diet-induced insulin resistant rats PLoS One, 9 (2014), Article e113784, 10.1371/journal.pone.0113784. 3.F. Baertling, F. Al-Murshedi, L. Sanchez-Caballero, K. Al-Senaidi, N.P. Joshi, H. Venselaar, M.A. van den Brand, L.G. Nijtmans, R.J. Rodenburg Mutation in mitochondrial complex IV subunit COX5A causes pulmonary arterial hypertension, lactic acidemia, and failure to thrive Hum. Mutat., 38 (2017), pp. 692-703, 10.1002/humu.23210. 4.L. Stiburek, K. Vesela, H. Hansikova, P. Pecina, M. Tesarova, L. Cerna, J. Houstek, J. Zeman.Tissue-specific cytochrome c oxidase assembly defects due to mutations in SCO2 and SURF1.Biochem. J., 392 (2005), pp. 625-632, 10.1042/BJ20050807. 5.S. Arnold, F. Goglia, B. Kadenbach.3,5-Diiodothyronine binds to subunit Va of cytochrome-c oxidase and abolishes the allosteric inhibition of respiration by ATP.Eur. J. Biochem., 252 (1998), pp. 325-330, 10.1046/j.1432-1327.1998.2520325.x. |