Primary Information |
|---|
| BoMiProt ID | Bomi4972 |
|---|
| Protein Name | Cysteine-rich protein 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VFX8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001073117.1 |
|---|
| Aminoacid Length | 208 |
|---|
| Molecular Weight | 22634 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CRIP2 |
|---|
| Gene ID | 780821 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Binding of CRP2 to F-actin accelerates actin polymerization and F-actin cluster formation. |
|---|
| Biochemical Properties | It consists of two LIM domains, which are double zinc-finger-like structures that mediate protein-protein interactions, and two glycine-rich regions.CRP family members (CRP1, CRP2/SmLIM, and CRP3/MLP) share a highly sequence homology, but their expression patterns differ depending on the type of tissue. |
|---|
| PTMs | N6-Acetylation at Lys, Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus OX=9913 GN=CRIP2 PE=2 SV=1
MASKCPKCDKTVYFAEKVSSLGKDWHRFCLRCEHCSKTLTPGGHAEHDGKPFCHKPCYAT
LFGPKGVNIGGAGSYIYEKPSAEKPQVTGPIEVPVARTEERKAS*104GPPKGPSKASSVTTFT
GEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG
ILFGPKGVNTGAVGSYIYDKDPEGKAQP
|
|---|
| Predicted Disorder Regions | 85-95, 99-120, 198-208 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Kihara T, Sugimoto Y, Shinohara S, Takaoka S, Miyake J. Cysteine-rich protein 2 accelerates actin filament cluster formation. PLoS One. 2017 Aug 16;12(8):e0183085. doi: 10.1371/journal.pone.0183085. PMID: 28813482; PMCID: PMC5558965. 2.Weiskirchen R, Gunther K. The CRP/MLP/TLP family of LIM domain proteins: acting by connecting. Bioessays. 2003;25(2):152–162. doi: 10.1002/bies.10226. |
|---|
