Primary Information |
---|
BoMiProt ID | Bomi4972 |
---|
Protein Name | Cysteine-rich protein 2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q0VFX8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001073117.1 |
---|
Aminoacid Length | 208 |
---|
Molecular Weight | 22634 |
---|
FASTA Sequence |
Download |
---|
Gene Name | CRIP2 |
---|
Gene ID | 780821 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | Binding of CRP2 to F-actin accelerates actin polymerization and F-actin cluster formation. |
---|
Biochemical Properties | It consists of two LIM domains, which are double zinc-finger-like structures that mediate protein-protein interactions, and two glycine-rich regions.CRP family members (CRP1, CRP2/SmLIM, and CRP3/MLP) share a highly sequence homology, but their expression patterns differ depending on the type of tissue. |
---|
PTMs | N6-Acetylation at Lys, Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus OX=9913 GN=CRIP2 PE=2 SV=1
MASKCPKCDKTVYFAEKVSSLGKDWHRFCLRCEHCSKTLTPGGHAEHDGKPFCHKPCYAT
LFGPKGVNIGGAGSYIYEKPSAEKPQVTGPIEVPVARTEERKAS*104GPPKGPSKASSVTTFT
GEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG
ILFGPKGVNTGAVGSYIYDKDPEGKAQP
|
---|
Predicted Disorder Regions | 85-95, 99-120, 198-208 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | 1.Kihara T, Sugimoto Y, Shinohara S, Takaoka S, Miyake J. Cysteine-rich protein 2 accelerates actin filament cluster formation. PLoS One. 2017 Aug 16;12(8):e0183085. doi: 10.1371/journal.pone.0183085. PMID: 28813482; PMCID: PMC5558965. 2.Weiskirchen R, Gunther K. The CRP/MLP/TLP family of LIM domain proteins: acting by connecting. Bioessays. 2003;25(2):152–162. doi: 10.1002/bies.10226. |