Primary Information |
|---|
| BoMiProt ID | Bomi4967 |
|---|
| Protein Name | Cysteine and glycine-rich protein 3/Cysteine-rich protein 3/CRP3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q4U0T9 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001019860.1 |
|---|
| Aminoacid Length | 194 |
|---|
| Molecular Weight | 20953 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CSRP3 |
|---|
| Gene ID | 540407 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | skeletal muscle |
|---|
| Protein Function | CSRP3 interacted with LC3 protein to promote the formation of autophagosomes during autophagy suggesting an important role in skeletal muscle remodeling and maintenance. |
|---|
| Biochemical Properties | The LIM domain is a zinc finger structure,which is involved in protein–protein interactions.consensus sequence of a LIM domain is CX2CX16_23HX2CX2CX2CX16_21CX2(C/H/D), where X denotes any amino acid |
|---|
| Significance in milk | glucose homeostasis in skeletal muscle |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus OX=9913 GN=CSRP3 PE=2 SV=1
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQS*95PKQARSATTSSNPSKFAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKS*153LESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTHQVEKKD
|
|---|
| Predicted Disorder Regions | 88-112, 187-194 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Cui C, Han S, Tang S, He H, Shen X, Zhao J, Chen Y, Wei Y, Wang Y, Zhu Q, Li D, Yin AH. The Autophagy Regulatory Molecule CSRP3 Interacts with LC3 and Protects Against Muscular Dystrophy. Int J Mol Sci. 2020 Jan 23;21(3):749. doi: 10.3390/ijms21030749. PMID: 31979369; PMCID: PMC7037376. |
|---|
