Search by BoMiProt ID - Bomi4962


Primary Information

BoMiProt ID Bomi4962
Protein Name Cyclin-dependent-like kinase 5/Cell division protein kinase 5 /Proline-directed protein kinase 33 kDa subunit/PDPK/Serine/threonine-protein kinase PSSALRE/Tau protein kinase II catalytic subunit/TPKII catalytic subunit
Organism Bos taurus
Uniprot IDQ02399
Milk FractionWhey
Ref Sequence ID NP_776442.1
Aminoacid Length 292
Molecular Weight 33288
FASTA Sequence Download
Gene Name CDK5/CDKN5
Gene ID 281066
Protein Existence Status reviewed

Secondary Information

Protein Function This is required for pain signaling in human sensory neurons and mouse models.
Biochemical Properties CDKL5 interacts with calcium/calmodulin-dependent protein kinase II α (CaMKIIα) to control outgrowth and transient receptor potential cation channel subfamily V member 1 (TRPV1)-dependent signaling
PTMs Acetylation at Lys and Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus OX=9913 GN=CDK5 PE=1 SV=2 MQKYEKLEKIGEGTY*15GT*17VFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH KNIVRLHDVLHS*72DKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYS*159AEVVTLWYRPPDVLFGAKLYS TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs  O-GlcNAc modification determined the conformation of critical T-loop domain on CDK5 and further influenced the CDK5 stability. 
Additional Comments Melatonin reduces proliferation and promotes apoptosis of bladder cancer cells by suppressing O-GlcNAcylation of CDK5.
Bibliography 1.Wu J, Tan Z, Li H, Lin M, Jiang Y, Liang L, Ma Q, Gou J, Ning L, Li X, Guan F. Melatonin reduces proliferation and promotes apoptosis of bladder cancer cells by suppressing O-GlcNAcylation of cyclin-dependent-like kinase 5. J Pineal Res. 2021 Oct;71(3):e12765. doi: 10.1111/jpi.12765. Epub 2021 Sep 18. PMID: 34487576. 2.La Montanara P, Hervera A, Baltussen LL, Hutson TH, Palmisano I, De Virgiliis F, Kong G, Chadwick J, Gao Y, Bartus K, Majid QA, Gorgoraptis N, Wong K, Downs J, Pizzorusso T, Ultanir SK, Leonard H, Yu H, Millar DS, Istvan N, Mazarakis ND, Di Giovanni S. Cyclin-dependent-like kinase 5 is required for pain signaling in human sensory neurons and mouse models. Sci Transl Med. 2020 Jul 8;12(551):eaax4846. doi: 10.1126/scitranslmed.aax4846. PMID: 32641489; PMCID: PMC7116442.