Primary Information |
|---|
| BoMiProt ID | Bomi4961 |
|---|
| Protein Name | Cyclin-dependent kinase 9/Cell division protein kinase 9 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EAB2 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001014935.2 |
|---|
| Aminoacid Length | 372 |
|---|
| Molecular Weight | 42748 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CDK9 |
|---|
| Gene ID | 520580 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Cyclin-dependent kinase 9 (CDK9) plays a vital role in transcription through regulation of short-lived anti-apoptotic genes required for cancer cell survival.CDK9 acts as a proto-oncogene in cervical cancer, modulating cell proliferation and apoptosis through AKT2/p53 pathway. |
|---|
| Biochemical Properties | Cyclin-dependent kinase 9 (CDK9), the functional subunit of the positive transcription elongation factor b, as a master regulator of inflammatory gene transcription in the process of promoter-proximal pausing to productive elongation. |
|---|
| PTMs | Acetylation, Phosphorylation at Ser, RING-type zinc finger-dependent and UBE2D1-dependent autoubiquitination. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus OX=9913 GN=CDK9 PE=2 SV=1
MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFS*175LAKNS
QPNRYT*186NRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDKYELFEKVELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGS*347QIT*350QQS*353T*354NQS*357RNPAT*362T*363NQTEFERVF
|
|---|
| Predicted Disorder Regions | 269-282, 340-372 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Cyclin-dependent kinase 9 acts a key transcriptional regulator and potential drug target in oncology, virology and cardiology. |
|---|
| Bibliography | 1.Xu J, Xu S, Fang Y, Chen T, Xie X, Lu W. Cyclin-dependent kinase 9 promotes cervical cancer development via AKT2/p53 pathway. IUBMB Life. 2019 Mar;71(3):347-356. doi: 10.1002/iub.1983. Epub 2018 Dec 11. PMID: 30536701. 2.Li J, Mao H, Pan Y, Li H, Lei L. Cyclin-Dependent Kinase 9 Inhibition Suppresses Necroptosis and Pyroptosis in the Progress of Endotoxemia. Inflammation. 2020 Dec;43(6):2061-2074. doi: 10.1007/s10753-020-01274-1. PMID: 32556803. 3.Alsfouk A. Small molecule inhibitors of cyclin-dependent kinase 9 for cancer therapy. J Enzyme Inhib Med Chem. 2021 Dec;36(1):693-706. doi: 10.1080/14756366.2021.1890726. PMID: 33632038; PMCID: PMC7919902. 4.Wang S, Fischer PM. Cyclin-dependent kinase 9: a key transcriptional regulator and potential drug target in oncology, virology and cardiology. Trends Pharmacol Sci. 2008 Jun;29(6):302-13. doi: 10.1016/j.tips.2008.03.003. Epub 2008 Apr 16. PMID: 18423896. |
|---|
