Primary Information |
|---|
| BoMiProt ID | Bomi4945 |
|---|
| Protein Name | Cyclic AMP-dependent transcription factor ATF-1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08DA8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001068757.1 |
|---|
| Aminoacid Length | 270 |
|---|
| Molecular Weight | 29261 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ATF1 |
|---|
| Gene ID | 506967 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Mediates PKA-induced stimulation of CRE-reporter genes.Represses the expression of FTH1 and other antioxidant detoxification genes. Triggers cell proliferation and transformation. |
|---|
| Biochemical Properties | This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. |
|---|
| PTMs | Phosphoprotein, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DA8|ATF1_BOVIN Cyclic AMP-dependent transcription factor ATF-1 OS=Bos taurus OX=9913 GN=ATF1 PE=2 SV=1
MEDSHKSNTSETAPQSGSTVQAAHISHIAQQVSSLSESEESQDSSDSIGSSQKTHGILAR
RPS*63YRKILKDLSSEDIRGRKGDGENPGVSAVTSMSVPTPIYQTSTGQYIAIAPNGALQLA
SPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQI
RTTPSATSLPQTVVMTS*197PVTLTSQTSKTDDPQLKREIRLMKNREAARECRRKKKEYVKCL
ENRVAVLENQNKTLIEELKTLKDLYSNKSV
|
|---|
| Predicted Disorder Regions | 1 disordered segment ; (1-231) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylated at Ser-197 by HIPK2 in response to genotoxic stress.CDK3-mediated phosphorylation at Ser-63 promotes its transactivation and transcriptional activities. |
|---|
| Bibliography | Kingsley-Kallesen ML, Kelly D, Rizzino A. Transcriptional regulation of the transforming growth factor-beta2 promoter by cAMP-responsive element-binding protein (CREB) and activating transcription factor-1 (ATF-1) is modulated by protein kinases and the coactivators p300 and CREB-binding protein. J Biol Chem. 1999 Nov 26;274(48):34020-8. doi: 10.1074/jbc.274.48.34020. PMID: 10567368. |
|---|
