Primary Information |
|---|
| BoMiProt ID | Bomi4939 |
|---|
| Protein Name | C-X-C chemokine receptor type 2(CXCR-2)/High affinity interleukin-8 receptor B(IL-8R B) |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q28003 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776785.1 |
|---|
| Aminoacid Length | 360 |
|---|
| Molecular Weight | 40625 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CXCR2/IL8RB |
|---|
| Gene ID | 281863 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Acts as Receptor for interleukin-8,thereby activates neutrophils upon binding of IL8 to C-X-C chemokine receptor type 2.Also CXCL1–CXCR2 signalling induces myocardial recruitment of monocytes, which is the key step for initiating Ang II-induced cardiac remodelling.Conserved residues in the carboxy terminal,potentially involved in the binding to PP2A, a phosphatase. |
|---|
| Biochemical Properties | is an ELR-positive receptor characterized by a glutamic acid-leucine-arginine (ELR) sequence and has high binding affinity to the chemokine ligands CXCL1 and CXCL2.Residues 311–330 of the C-terminal domain of CXCR2 is responsible for binding to PP2A, a phosphatase.Lys315, Arg317, His318, and Leu320 are important for the receptor binding to the PP2A core enzyme.The integrity of the sequence motif, KFRHGL, is required for the interaction of CXCR2 with PP2A. |
|---|
| PTMs | Phosphorylation,Glycosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q28003|CXCR2_BOVIN C-X-C chemokine receptor type 2 OS=Bos taurus OX=9913 GN=CXCR2 PE=2 SV=1
MTIILKDLSN*10SSILWEGFEDEFGN*24YSGTPPTEDYDYSPCEISTETLNKYAVVVIDALVFL
LSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFAMTLPIWTASKAKGWVFGTPLCK
VVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKWHWVKFICLGIWALSVILALPI
FIFREAYQPPYSDLVCYEDLGANTTKWRMIMRVLPQTFGFLLPLLVMLFCYGFTLRTLFS
AQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRNDIGRALDATE
ILGFLHSCLNPLIYVFIGQKFRHGLLKIMAIHGLISKEFLAKDGRPSFVGSSSGNTSTTL
|
|---|
| Predicted Disorder Regions | 11-39, 339-360 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 6TMHs; (52-74), (85-107), (130-148), (161-183), (217-239), (252-270) |
|---|
| Significance of PTMs | Phosphorylated upon ligand binding; which is required for desensitization.phosphorylated receptor is then internalized via clathrin-coated pits into early endosomes and subsequently dephosphorylated by intracellular protein phosphatases.PP2A is involved in the dephosphorylation of CXCR2 and plays an important role in regulating the receptor signaling. |
|---|
| Additional Comments | CXCR2 mediates accumulation of pro-inflammatory cells that likely contribute to adverse cardiac remodelling and dysfunction.knocking down the chemokine receptor CXCR2 (IL8RB) alleviates both replicative and oncogene-induced senescence (OIS) and diminishes the DNA-damage response. |
|---|
| Bibliography | 1.Wang L, Zhang YL, Lin QY, Liu Y, Guan XM, Ma XL, Cao HJ, Liu Y, Bai J, Xia YL, Du J, Li HH. CXCL1-CXCR2 axis mediates angiotensin II-induced cardiac hypertrophy and remodelling through regulation of monocyte infiltration. Eur Heart J. 2018 May 21;39(20):1818-1831. doi: 10.1093/eurheartj/ehy085. Erratum in: Eur Heart J. 2019 Jan 1;40(1):49. PMID: 29514257. 2.Fan GH, Yang W, Sai J, Richmond A. Phosphorylation-independent association of CXCR2 with the protein phosphatase 2A core enzyme. J Biol Chem. 2001 May 18;276(20):16960-8. doi: 10.1074/jbc.M009292200. Epub 2001 Feb 26. PMID: 11278485; PMCID: PMC2666306. |
|---|
