Primary Information |
|---|
| BoMiProt ID | Bomi4899 |
|---|
| Protein Name | Coxsackievirus and adenovirus receptor homolog/BCAR |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q8WMV3 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_776723.1 |
|---|
| Aminoacid Length | 365 |
|---|
| Molecular Weight | 40153 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CXADR |
|---|
| Gene ID | 281733 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | conceptus |
|---|
| Protein Function | Coxsackievirus and adenovirus receptor (CAR) can interact with post-synaptic density 95 (PSD-95) and localize PSD-95 to cell-cell junctions.CAR can play a role in trafficking proteins, including ion channels, in a PDZ-based scaffolding complex. |
|---|
| Biochemical Properties | CAR contains a class 1 PSD-95/Drosophila discs-large protein/zonula occludens protein-1 (PDZ)-binding domain at its C-terminus and is known to interact with and affect the trafficking of several PDZ domain-containing scaffolding proteins, such as PSD-95, MAGI-1, PICK1, and MUPP-1. |
|---|
| PTMs | Disulfide bond formation,N-Linked Glycosylation at Asn, Lipoylation, Palmitoylation, Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8WMV3|CXAR_BOVIN Coxsackievirus and adenovirus receptor homolog OS=Bos taurus OX=9913 GN=CXADR PE=2 SV=1
MELLLRFLLLCGVADFTRGLSITTPEQMIEKAKGETAYLPCKFTLGPEDQGPLDIEWLLS
PADNQKVDQVIILYSGDKIYDDYYQDLKGRVHFTSNDLKSGDASIN*106VTNLQLSDIGTYQC
KVKKAPGVGNKKIQLTVLVKPSGIRCYVDGSEEIGNDFKLKCEPKEGSLPLRYEWQKLSD
SQKLPTSWLPEMTSPVISVKNASAEYSGTYTCTVRNRVGSDQCLLRLDVVPPSNRAGTIA
GAVIGTLLALVLIALIVFCCHKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGS*297NHS
SLGS*304MS*306PSNMEGYSKTQYNQVPS*323EDLERAPQS*332PTLPPAKVAAPNLSRMGAVPVMIPAQSKDGS*363IV
|
|---|
| Predicted Disorder Regions | 126-132, 271-365 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (236-258) |
|---|
| Significance of PTMs | Palmitoylation on Cys-259,260; required for proper localization to the plasma membrane. |
|---|
| Bibliography | 1.Excoffon KJ, Hruska-Hageman A, Klotz M, Traver GL, Zabner J. A role for the PDZ-binding domain of the coxsackie B virus and adenovirus receptor (CAR) in cell adhesion and growth. J Cell Sci. 2004;117:4401–4409. 2.Coyne CB, Voelker T, Pichla SL, Bergelson JM. The coxsackievirus and adenovirus receptor interacts with the multi-PDZ domain protein-1 (MUPP-1) within the tight junction. J Biol Chem. 2004;279:48079–48084. 3.Excoffon KJ, Kolawole AO, Kusama N, Gansemer ND, Sharma P, Hruska-Hageman AM, Petroff E, Benson CJ. Coxsackievirus and adenovirus receptor (CAR) mediates trafficking of acid sensing ion channel 3 (ASIC3) via PSD-95. Biochem Biophys Res Commun. 2012 Aug 17;425(1):13-8. doi: 10.1016/j.bbrc.2012.07.033. Epub 2012 Jul 15. PMID: 22809504; PMCID: PMC3423544. |