Primary Information |
|---|
| BoMiProt ID | Bomi4734 |
|---|
| Protein Name | Claudin-4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q6BBL6 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001014413.1 |
|---|
| Aminoacid Length | 209 |
|---|
| Molecular Weight | 22165 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CLDN4 |
|---|
| Gene ID | 414921 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | placenta |
|---|
| Protein Function | claudin-4 is a transmembrane protein that plays an important role in tight junctions.Claudin-4 regulates cell proliferation, invasion, migration and apoptosis. |
|---|
| PTMs | Disulfide bond formation, Phosphorylation at Tyr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q6BBL6|CLD4_BOVIN Claudin-4 OS=Bos taurus OX=9913 GN=CLDN4 PE=2 SV=1
MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV
AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL
LCFNCPPRNDKPYSAKYSAARSAPASNY*208V
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 4TMHs; (4-26),(82-100),(119-141),(161-183) |
|---|
| Significance of PTMs | Phosphorylation by EPHA2 is stimulated by EFNA1 and alters interaction with TJP1. |
|---|
| Additional Comments | Claudin-4 expression is widely dysregulated in epithelial malignancies and in a number of premalignant precursor lesions. |
|---|
| Bibliography | 1.Liu W, Li M. The role of claudin-4 in the development of gastric cancer. Scand J Gastroenterol. 2020 Sep;55(9):1072-1078. doi: 10.1080/00365521.2020.1795923. Epub 2020 Jul 25. PMID: 32715822. 2.Neesse A, Griesmann H, Gress TM, Michl P. Claudin-4 as therapeutic target in cancer. Arch Biochem Biophys. 2012 Aug 1;524(1):64-70. doi: 10.1016/j.abb.2012.01.009. Epub 2012 Jan 24. PMID: 22286027. |
|---|
