Primary Information |
|---|
| BoMiProt ID | Bomi4719 |
|---|
| Protein Name | Citrate synthase, mitochondrial/Citrate (Si)-synthase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q29RK1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001038186.1 |
|---|
| Aminoacid Length | 466 |
|---|
| Molecular Weight | 51773 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CS |
|---|
| Gene ID | 280682 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Citrate synthase (CS) catalyzes the conversion of oxaloacetate and acetyl coenzyme A into citrate and coenzyme A in the mitochondrial tricarboxylic acid (TCA) cycle. |
|---|
| Biochemical Properties | The enzyme citrate synthase is localized in the mitochondrial matrix and thus can be used as a quantitative enzyme marker of intact mitochondrial mass. Given that many molecules and pathways that have important functions in mitochondria are highly conserved between humans and Drosophila.Plant mitochondrial CS, CSY4 from Arabidopsis thaliana (AtCSY4), has been determined and it's structural comparison of AtCSY4 with mitochondrial CSs revealed a high level of similarity. |
|---|
| Significance in milk | variation in milk citrate with stage of lactation is related to de novo synthesis of fatty acids. |
|---|
| PTMs | N6-Acetylation at Lys, Trimethylation at Lys-395 , Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q29RK1|CISY_BOVIN Citrate synthase, mitochondrial OS=Bos taurus OX=9913 GN=CS PE=1 SV=1
MALLTAAARLFGAKNASCLVLAARHASASSTNLKDILADLIPKEQTRVKAFRQQHGKTVV
GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGEEPLPEGLF
WLLVTGQIPTEEQVSWLSQEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSEST
FARAYSEGINRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSS*226IGAIDPKLDWSHNF
TNMLGYTDAQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPL
HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQ
REFALKHLPQDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYY
TVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLMKFVDSKSG
|
|---|
| Predicted Disorder Regions | 457-466 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Trimethylation at Lys-395 by CSKMT decreases citrate synthase activity. |
|---|
| Additional Comments | Expression of citrate synthase during germination and in response to light is regulated by methylation of promoters of corresponding genes. |
|---|
| Bibliography | 1.Nishio K, Mizushima T. Structural and biochemical characterization of mitochondrial citrate synthase 4 from Arabidopsis thaliana. Acta Crystallogr F Struct Biol Commun. 2020 Mar 1;76(Pt 3):109-115. doi: 10.1107/S2053230X20001521. Epub 2020 Mar 1. PMID: 32133996; PMCID: PMC7057349. 2.Wei P, Liu Q, Xue W, Wang J. A Colorimetric Assay of Citrate Synthase Activity in Drosophila Melanogaster. J Vis Exp. 2020 Jan 16;(155). doi: 10.3791/59454. PMID: 32009637. 3.Eprintsev AT, Fedorin DN, Dobychina MA, Igamberdiev AU. Regulation of expression of the mitochondrial and peroxisomal forms of citrate synthase in maize during germination and in response to light. Plant Sci. 2018 Jul;272:157-163. doi: 10.1016/j.plantsci.2018.04.017. Epub 2018 Apr 21. PMID: 29807587. |
|---|
