Primary Information |
---|
BoMiProt ID | Bomi4655 |
---|
Protein Name | Chloride channel CLIC-like protein 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q1LZF8 |
---|
Milk Fraction | Whey,MFGM |
---|
Ref Sequence ID | NP_001069252.1 |
---|
Aminoacid Length | 542 |
---|
Molecular Weight | 61812 |
---|
FASTA Sequence |
Download |
---|
Gene Name | CLCC1 |
---|
Gene ID | 519085 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | They are implicated in cell volume regulation, acidification, and cell cycle regulation. |
---|
Biochemical Properties | CLICs resemble the omega class of Glutathione S-transferases (GST), yet differ from them in their ability to form ion channels. They are ubiquitously found in eukaryotes but no prokaryotic homolog has been characterized |
---|
PTMs | Phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1LZF8|CLCC1_BOVIN Chloride channel CLIC-like protein 1 OS=Bos taurus OX=9913 GN=CLCC1 PE=2 SV=1
MLYSLLLCECLWLITAYAHDDEWIDPTDMLNYDAASGRMRKSQVKYGISEKEEVNPDLSC
ANELSECYNRLDSLTYKIDECEKQKRKDYESQSNPVFRRYLNKILIETKKLGLPDENKHD
MHYDAEIILKRQTLLEIQKFLSGEDWKPGALDDALSDILINFKFHDFETWKWRFEEFFGV
DPYNVFMVLLCLLCIVALVATELWTYVRWYTQLKRVFFISFLISLGWNWMYLYKLAFAQH
QAEVAKMEPLNNVCAEKMNWSGSLWEWLRSSWTYKDDPCQKYYELLLVNPIWLVPPTKAL
AVTFTNFVTEPLKHVGKGAGEFIKALMKEIPVLLHIPVLIIMALAVLSFCYGAGKSVNML
RHVGGPEREAPQALQAGERRRQQKIDYRPHGGAGDADFYYRGQISPIEQGPNDNTYEGRR
DVLRERDVGLRFQTGNKS*438PEVLRPFDLQEAEAREHPKVVPGLKS*464PNLESKPREMGEIPGE
ST*482PTESSTESSQPAKPVSGQKVSEGVEGCPAVEKAQLRTDAAGGPEEGSTCS*532PASTAVEV
CG
|
---|
Predicted Disorder Regions | 393-412, 434-439, 450-542 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 3TMHs; (183-205),(216-238),(330-352) |
---|
Additional Comments | The genome of Arabidopsis thaliana contains unusual members of the glutathione S-transferase (GST) superfamily with a cysteine in place of a serine at the active site. Four of these genes (at-dhar 1-4) have an appreciable homology to intracellular Cl- channels (CLICs) from vertebrates and invertebrates. |
---|
Bibliography | 1.Elter A, Hartel A, Sieben C, Hertel B, Fischer-Schliebs E, Lüttge U, Moroni A, Thiel G. A plant homolog of animal chloride intracellular channels (CLICs) generates an ion conductance in heterologous systems. J Biol Chem. 2007 Mar 23;282(12):8786-92. doi: 10.1074/jbc.M607241200. Epub 2007 Jan 31. PMID: 17267397. 2.Gururaja Rao S, Ponnalagu D, Sukur S, Singh H, Sanghvi S, Mei Y, Jin DJ, Singh H. Identification and Characterization of a Bacterial Homolog of Chloride Intracellular Channel (CLIC) Protein. Sci Rep. 2017 Aug 17;7(1):8500. doi: 10.1038/s41598-017-08742-z. PMID: 28819106; PMCID: PMC5561075. |