Primary Information |
|---|
| BoMiProt ID | Bomi4635 |
|---|
| Protein Name | Ceramide synthase 2/LAG1 longevity assurance homolog 2/Sphingosine N-acyltransferase CERS2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBF8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029839.1 |
|---|
| Aminoacid Length | 380 |
|---|
| Molecular Weight | 44903 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CERS2/LASS2 |
|---|
| Gene ID | 539223 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | ceramide synthase 2 regulates the levels of the S1P precursor sphingosine. involved in the regulation of S1P gradients and S1P-dependent egress into the circulation. |
|---|
| Biochemical Properties | catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27) |
|---|
| PTMs | Acetylation,Phosphorylation, |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus OX=9913 GN=CERS2 PE=2 SV=1
MLQTLHDYFWWERLWLPVN*19LTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV
ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY
WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERS*341DREET*346ES*348S*349EGEEAAAGGGAKNRPLANGHPILNNNHRKND
|
|---|
| Predicted Disorder Regions | 91-103, 341-380 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 5TMHs; (46-68), (136-154), (210-228), (263-285), (300-322) |
|---|
| Significance of PTMs | Acetylated. Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Phosphorylated at the C-terminus by CK2, leading to increase the ceramide synthase activity. |
|---|
| Bibliography | Rieck M, Kremser C, Jobin K, Mettke E, Kurts C, Gräler M, Willecke K, Kolanus W. Ceramide synthase 2 facilitates S1P-dependent egress of thymocytes into the circulation in mice. Eur J Immunol. 2017 Apr;47(4):677-684. doi: 10.1002/eji.201646623. Epub 2017 Feb 27. PMID: 28198542. |
|---|
