Primary Information |
---|
BoMiProt ID | Bomi4635 |
---|
Protein Name | Ceramide synthase 2/LAG1 longevity assurance homolog 2/Sphingosine N-acyltransferase CERS2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3ZBF8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001029839.1 |
---|
Aminoacid Length | 380 |
---|
Molecular Weight | 44903 |
---|
FASTA Sequence |
Download |
---|
Gene Name | CERS2/LASS2 |
---|
Gene ID | 539223 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | ceramide synthase 2 regulates the levels of the S1P precursor sphingosine. involved in the regulation of S1P gradients and S1P-dependent egress into the circulation. |
---|
Biochemical Properties | catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27) |
---|
PTMs | Acetylation,Phosphorylation, |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus OX=9913 GN=CERS2 PE=2 SV=1
MLQTLHDYFWWERLWLPVN*19LTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV
ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR
RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY
WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD
SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF
GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERS*341DREET*346ES*348S*349EGEEAAAGGGAKNRPLANGHPILNNNHRKND
|
---|
Predicted Disorder Regions | 91-103, 341-380 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 5TMHs; (46-68), (136-154), (210-228), (263-285), (300-322) |
---|
Significance of PTMs | Acetylated. Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Phosphorylated at the C-terminus by CK2, leading to increase the ceramide synthase activity. |
---|
Bibliography | Rieck M, Kremser C, Jobin K, Mettke E, Kurts C, Gräler M, Willecke K, Kolanus W. Ceramide synthase 2 facilitates S1P-dependent egress of thymocytes into the circulation in mice. Eur J Immunol. 2017 Apr;47(4):677-684. doi: 10.1002/eji.201646623. Epub 2017 Feb 27. PMID: 28198542. |