Primary Information |
|---|
| BoMiProt ID | Bomi4598 |
|---|
| Protein Name | Cell division cycle protein 123 homolog |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2YDG3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001073743.1 |
|---|
| Aminoacid Length | 335 |
|---|
| Molecular Weight | 38923 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CDC123 |
|---|
| Gene ID | 514926 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Cdc123 makes an essential contribution to the onset of mRNA translation by assembling the eIF2 complex from its three protein subunits. |
|---|
| Biochemical Properties | Mutations of CDC123 lead to an increase of GCN4 expression that is independent of Gcn2 kinase and eIF2-ser52 phosphorylation. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2YDG3|CD123_BOVIN Cell division cycle protein 123 homolog OS=Bos taurus OX=9913 GN=CDC123 PE=2 SV=1
MKKEHVLHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPAHSQPDS*60
DDEAEEIQWSDDENTATLTAPEFPEFTTKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNS
SLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCMEYELVLRKWCELIPGAEFRC
FVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKKHIQYKFLDEDFVFDIYRDSRG
KVWLIDFNPFGEVTDSLLFTWDELLSGTNLKGDFSEEALEQDAPAFRCTNSEVTVQPSPY
LSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
|
|---|
| Predicted Disorder Regions | 45-82, 330-335 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Mutations of CDC123 lead to an increase of GCN4 expression that is independent of Gcn2 kinase and eIF2-ser52 phosphorylation. |
|---|
| Bibliography | Perzlmaier, A. F.; Richter, F.; Seufert, W. (2013). Translation Initiation Requires Cell Division Cycle 123 (Cdc123) to Facilitate Biogenesis of the Eukaryotic Initiation Factor 2 (eIF2). Journal of Biological Chemistry 288(30), 21537–21546.doi:10.1074/jbc.M113.472290 |
|---|
