Primary Information |
|---|
| BoMiProt ID | Bomi4567 |
|---|
| Protein Name | CD44 antigen/Extracellular matrix receptor III/HUTCH-I/GP90 lymphocyte homing/adhesion receptor |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q29423 |
|---|
| Milk Fraction | Exosomes |
|---|
| Aminoacid Length | 366 |
|---|
| Molecular Weight | 40002 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CD44 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Mesenteric lymph node and liver |
|---|
| Protein Function | CD44 is a cell surface adhesion molecule, which is overexpressed on cancer stem cells. The interaction of CD44 with hyaluronan is responsible for tumor development, metastasis, and expression of the chemoresistant phenotype. |
|---|
| PTMs | Disulfide bond formation,N-Linked Glycosylation at Asn, Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q29423|CD44_BOVIN CD44 antigen OS=Bos taurus OX=9913 GN=CD44 PE=2 SV=1
MDTFWWRAAWGLCLVQLSLAQIDLN*25ITCRYAGVFHVEKNGRYSISKTEAADLCKAFN*57STL
PTMAQMEAARNIGFETCRYGFIEGHVVIPRIHPNSICAAN*100NTGVYILTSN*110TSQYDTICFN*120
ASAPPGEDCTSVTDLPNAFEGPITITIVNRDGTRYTKKGEYRTNPEDINPSVVSPSSPPD
DEMSSGSPSERSTSGGYSIFHTHLPTVHPSRPRRPWSQRAEN*222TSDTRDYGSSHDPSGRSY
TTHASESAGHSSGSEEHGAN*260TTSGPMRKPQIPEWLIILASLLALALILAVCIAVNS*296RRRC
GQKKKLVINNGNGT*314MEERKPS*321GLNGEASKS*330QEMVHLVNKGSSETPDQFMTADETRNLQNV
DMKIGV
|
|---|
| Predicted Disorder Regions | 125-140, 152-268, 296-303, 311-330, 338-353 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (274-296) |
|---|
| Significance of PTMs | Activation of PKC results in the dephosphorylation of Ser-330 (constitutive phosphorylation site), and the phosphorylation of Ser-296.N-Linked Glycosylation at Asn leads to the additional structural diversity of CD44 |
|---|
| Additional Comments | The overexpression of CD44 impedes the cytotoxic effect of chemotherapy medications in various cancers. Therefore, the high expression of CD44 is associated with a poor prognosis in affected patients. |
|---|
| Bibliography | 1.Yaghobi Z, Movassaghpour A, Talebi M, Abdoli Shadbad M, Hajiasgharzadeh K, Pourvahdani S, Baradaran B. The role of CD44 in cancer chemoresistance: A concise review. Eur J Pharmacol. 2021 Jul 15;903:174147. doi: 10.1016/j.ejphar.2021.174147. Epub 2021 May 5. PMID: 33961871. 2.J. Cichy, E. Puré.The liberation of CD44.J. Cell Biol., 161 (2003), pp. 839-843, 10.1083/jcb.200302098. 3. |