Primary Information |
|---|
| BoMiProt ID | Bomi4562 |
|---|
| Protein Name | CD151 antigen/CD_antigen: CD151 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBH3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001030424.1 |
|---|
| Aminoacid Length | 253 |
|---|
| Molecular Weight | 27987 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CD151 |
|---|
| Gene ID | 523328 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | adipose tissue |
|---|
| Protein Function | CD151 regulates post-adhesion events, that is, cell spreading, migration and invasion including subsequent intravasation and formation of metastasis. |
|---|
| Biochemical Properties | CD151 consists of four transmembrane domains, two extracellular (EC1 and EC2) and one intracellular loop, and NH2- and COOH-terminal cytoplasmic domains.CD151 is clustered at the cell membrane in specialized multimeric aggregates, ie, tetraspanin-enriched microdomains. |
|---|
| PTMs | N-Linked Glycosylation at Asn, Lipoylation, Palmitoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBH3|CD151_BOVIN CD151 antigen OS=Bos taurus OX=9913 GN=CD151 PE=2 SV=1
MGEFGEKSTTCGTVCLKYLLFTFNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT
AYILVVAGIVVMVTGALGCCATFKERRNLLRLYFGLLLIIFLLEIIAGALAYIYYQQLNA
ELKENLKDTMTRRYHQPGHEGVTSAVDKLQQEFHCCGSN*159NSRDWQDSEWIHSGEAGGRVV
PDSCCKTVVPGCGRRDHASNIYKVEGGCITKLETFIQEHLRIIGAVGLGIACVQVFGMLF
TCCLYKSLKLEHY
|
|---|
| Predicted Disorder Regions | (1-6) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 4TMHs; (20-42),(57-79),(92-114),(222-244) |
|---|
| Significance of PTMs | Palmitoylation by ZDHHC2 regulates CD151 expression, association with other tetraspanin family proteins and function in cell adhesion. |
|---|
| Bibliography | 1.Sadej R, Grudowska A, Turczyk L, Kordek R, Romanska HM. CD151 in cancer progression and metastasis: a complex scenario. Lab Invest. 2014 Jan;94(1):41-51. doi: 10.1038/labinvest.2013.136. Epub 2013 Nov 18. PMID: 24247563. 2.Fitter S, Tetaz TJ, Berndt MC et al. Molecular cloning of cDNA encoding a novel platelet-endothelial cell tetra-span antigen, PETA-3. Blood 1995;86:1348–1355. |
|---|
