Primary Information |
|---|
| BoMiProt ID | Bomi4545 |
|---|
| Protein Name | CCAAT/enhancer-binding protein beta |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | O02755 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_789745.1 |
|---|
| Aminoacid Length | 348 |
|---|
| Molecular Weight | 36390 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CEBPB |
|---|
| Gene ID | 338319 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | immune and inflammatory responses.Role in gluconeogenic pathway,adipose tissue differentiation, glucose and insulin metabolism, triacylglycerol metabolism, hepatic steatosis, endoplasmic reticulum stress, and HDL production.C/EBP-β plays an important role in promoting the development and differentiation of both white and brown adipose tissue. C/EBPβ inactivation regulates macrophage foam cell formation in atherogenesis by reducing inflammation, ER stress, and apoptosis and by promoting autophagy and inactivating mTOR. |
|---|
| Biochemical Properties | All members of the C/EBP family contain a basic leucine zipper (bZIP) domain at the carboxyl-terminus (C-terminus), which is involved in dimerization and binding to the DNA |
|---|
| Significance in milk | critical transcription factors in adipogenesis |
|---|
| PTMs | Methylation on Arg ,and Phosphorylation on Ser and Thr.Glycosylation on Ser.Acetylation on Lys.Sumoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O02755|CEBPB_BOVIN CCAAT/enhancer-binding protein beta OS=Bos taurus OX=9913 GN=CEBPB PE=3 SV=1
MQRLVVWDPVCLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPADRPGPRPPT
GELGSIGEHERAIDFSPYLEPLGAPQAPAPTTASDTFEAAPSAPAPVPASSGQHHDFLSD
LFSDDYGGKNCKKAAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAAGMAAGFPYALRAYLGYQAVPSGSSGSLST*227S*228S*229SSS*232PPGT*236PSPADAKATPAAAACYAGAAPAPSQVKSKAKKT*269VDKHSDEYKIRRERNNIAVRKS*291RDKAKMRNL
ETQHKVLELTGENERLQKKVEQLSREVS*328TLRNLFKTLPEPLLASSGHC
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (39-141), (160-248), (259-324) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Acetylation at Lys-43 is imp to transactivate target genes, those associated with adipogenesis and adipocyte function. Deacetylation by HDAC1 represses its transactivation activity. Acetylated by KAT2A and KAT2B within a cluster of lysine residues between amino acids 129-133, this acetylation is strongly induced by glucocorticoid treatment and enhances transactivation activity.O-glycosylated, glycosylation at Ser-228 and Ser-229 prevents phosphorylation on Thr-236, Ser-232 and Thr-227 and DNA binding activity which delays the adipocyte differentiation program.Phosphorylation at Thr-269 enhances transactivation activity.Methylated. Methylation at Arg-3 by CARM1 and at Lys-43 by EHMT2 inhibit transactivation activity. Methylation is probably inhibited by phosphorylation at Thr-236.Sumoylation at Lys-174 is for inhibition of T-cells proliferation. |
|---|
| Additional Comments | A decreased hepatic C/EBP-β expression coincides with increased insulin production .C/EBP-β knockout mice die early due to disturbances in glycogen mobilization and consequent hypoglycemia. |
|---|
| Bibliography | van der Krieken SE, Popeijus HE, Mensink RP, Plat J. CCAAT/enhancer binding protein β in relation to ER stress, inflammation, and metabolic disturbances. Biomed Res Int. 2015;2015:324815. doi: 10.1155/2015/324815. Epub 2015 Jan 28. PMID: 25699273; PMCID: PMC4324884. |
|---|
