Primary Information |
|---|
| BoMiProt ID | Bomi4544 |
|---|
| Protein Name | CCAAT/enhancer-binding protein alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | O02754 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 353 |
|---|
| Molecular Weight | 37218 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CEBPA |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting as an activator on distinct target genes.plays essential and redundant functions with CEBPB.Necessary for terminal adipocyte differentiation, is required for postnatal maintenance of systemic energy homeostasis and lipid storage. |
|---|
| Biochemical Properties | Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting as an activator on distinct target genes.To modulate lipogenesis, interacts and transcriptionally synergizes with SREBF1 in promoter activation of specific lipogenic target genes such as ACAS2. In adipose tissue, seems to act as FOXO1 coactivator accessing to ADIPOQ promoter through FOXO1 binding sites. |
|---|
| Significance in milk | During early embryogenesis, plays essential and redundant functions with CEBPB. Essential for the transition from common myeloid progenitors (CMP) to granulocyte/monocyte progenitors (GMP). Critical for the proper development of the liver and the lung. Necessary for terminal adipocyte differentiation, is required for postnatal maintenance of systemic energy homeostasis and lipid storage. |
|---|
| PTMs | Phosphorylation ,sumoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O02754|CEBPA_BOVIN CCAAT/enhancer-binding protein alpha OS=Bos taurus OX=9913 GN=CEBPA PE=3 SV=1
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPSQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGGGNDFDYPGAPVGPGGAVMPG
GTHGPPPGYGCAAAGYLDSRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPNSHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPT*222PPPT*226PVPS*230PHPAPALGAAGLPGPGGALKGLVATHPDLRAGGGGGGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQ
RNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
|
|---|
| Predicted Disorder Regions | 4 disordered segments; (1-136), (153-217), (233-246), (256-322) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Significance of PTMs | Phosphorylation at Ser-190 is required for interaction with CDK2, CDK4 and SWI/SNF complex leading to cell cycle inhibition.Po4 removal at Ser-190 by protein phosphatase 2A (PP2A) is imp for PI3K/AKT signaling pathway regulation.Phosphorylation of the GSK3 consensus sites selectively decreases transactivation activity on IRE-controlled promoters. |
|---|
| Bibliography | Khanna-Gupta A. Sumoylation and the function of CCAAT enhancer binding protein alpha (C/EBP alpha). Blood Cells Mol Dis. 2008 Jul-Aug;41(1):77-81. doi: 10.1016/j.bcmd.2008.02.011. Epub 2008 Apr 10. PMID: 18406180; PMCID: PMC2505045. |