Primary Information |
---|
BoMiProt ID | Bomi4533 |
---|
Protein Name | Caveolae-associated protein 4/Muscle-related coiled-coil protein/Muscle-restricted coiled-coil protein |
---|
Organism | Bos taurus |
---|
Uniprot ID | A5PJI6 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001096734.2 |
---|
Aminoacid Length | 361 |
---|
Molecular Weight | 41161 |
---|
FASTA Sequence |
Download |
---|
Gene Name | CAVIN4/MURC |
---|
Gene ID | 528386 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | MURC is involved in the skeletal myogenesis that results from modulation of myogenin expression and ERK activation. MURC may play pivotal roles in the molecular mechanisms of skeletal myogenic differentiation. |
---|
Biochemical Properties | MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance |
---|
PTMs | Phosphorylation at Ser/Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A5PJI6|CAVN4_BOVIN Caveolae-associated protein 4 OS=Bos taurus OX=9913 GN=CAVIN4 PE=2 SV=2
MEHNGSASNADKIHQNRLSNVTEDEDQDAALTIVTVLDKVAAIVDSVQASQKRIEERHRV
MENAIKSVQIDLLKFSQSHSNTGYVINKLFEKTRKVSAHIKDVKARVEKQQTHVKKVEAK
QEEIMKKNKFRVVIFQEEVQCPTSLSVVKDRS*152LTESPEEVDEIFDTPVDLS*171S*172DEEYFVEE
SRSARLKKSGKERIDNIKKAFSKENMQKTRQNFDKKVNRIRTRIVTPERRERLRQSGERL
RQSGERLKQSGERFKKSISNAAPSREAFKMRSLRKTKDRAVAEGPEEVREMGVDIIARGE
ALGPISELYPEALSETDPEEASATHPPQEGGEVST*335PEPLKVTFKPQVKVEDDES*354LLLDLK
Q
|
---|
Predicted Disorder Regions | 1-26, 52-60, 100-111, 159-168, 176-361 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Overexpression of MURC in C2C12 myoblasts resulted in the promotion of differentiation with enhanced myogenin expression and ERK activation during differentiation. |
---|
Bibliography | 1.Tagawa M, Ueyama T, Ogata T, Takehara N, Nakajima N, Isodono K, Asada S, Takahashi T, Matsubara H, Oh H. MURC, a muscle-restricted coiled-coil protein, is involved in the regulation of skeletal myogenesis. Am J Physiol Cell Physiol. 2008 Aug;295(2):C490-8. doi: 10.1152/ajpcell.00188.2008. Epub 2008 May 28. PMID: 18508909. 2.Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T, Harada K, Takahashi T, Shioi T, Matsubara H, Oh H. MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance. Mol Cell Biol. 2008 May;28(10):3424-36. doi: 10.1128/MCB.02186-07. Epub 2008 Mar 10. PMID: 18332105; PMCID: PMC2423172. |