Primary Information |
|---|
| BoMiProt ID | Bomi4512 |
|---|
| Protein Name | Catenin beta-1/Beta-catenin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VCX4 |
|---|
| Milk Fraction | Exosomes,MFGM |
|---|
| Ref Sequence ID | NP_001069609.1 |
|---|
| Aminoacid Length | 781 |
|---|
| Molecular Weight | 85511 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CTNNB1 |
|---|
| Gene ID | 539003 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | uterine horn |
|---|
| Protein Function | CTNNB1 signaling is a key pathway that is involved in the pathogenesis and progression of Colorectal cancer. |
|---|
| PTMs | N-Acetylation at Ala,O-Linked Glycosylation at Ser, Phosphorylation at Ser, S-nitrosylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCX4|CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=CTNNB1 PE=1 SV=1
MATQADLMELDMAMEPDRKAAVS*23*23HWQQQS*29YLDS*33GIHS*37GATT*41TAPS*45LSGKGNPEEEDVDTTQVLY*64EWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINY*142QDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRS*191PQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGS*246PVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTY*331TY*333EKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTS*552MGGT*556QQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLS*675VELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
|
|---|
| Predicted Disorder Regions | 18-86, 742-780 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation at Ser-552 by AMPK promotes stabilizion of the protein, enhancing TCF/LEF-mediated transcription.S-nitrosylation at Cys-619 within adherens junctions promotes VEGF-induced, NO-dependent endothelial cell permeability by disrupting interaction with E-cadherin, thus mediating disassembly adherens junctions.O-glycosylation at Ser-23 decreases nuclear localization and transcriptional activity, and increases localization to the plasma membrane and interaction with E-cadherin CDH1. |
|---|
| Additional Comments | Blockade of β-catenin/TCF not only prevents TGF-β1 induced EMT and profibrogenic effects involved in pathological remodeling of airway, but also alleviates airway inflammation in asthma by balancing pro-inflammatory and anti-inflammatory cytokine. |
|---|
| Bibliography | 1.Wu H, Lu XX, Wang JR, Yang TY, Li XM, He XS, Li Y, Ye WL, Wu Y, Gan WJ, Guo PD, Li JM. TRAF6 inhibits colorectal cancer metastasis through regulating selective autophagic CTNNB1/β-catenin degradation and is targeted for GSK3B/GSK3β-mediated phosphorylation and degradation. Autophagy. 2019 Sep;15(9):1506-1522. doi: 10.1080/15548627.2019.1586250. Epub 2019 Mar 4. PMID: 30806153; PMCID: PMC6693460. 2.Huo R, Tian X, Chang Q, Liu D, Wang C, Bai J, Wang R, Zheng G, Tian X. Targeted inhibition of β-catenin alleviates airway inflammation and remodeling in asthma via modulating the profibrotic and anti-inflammatory actions of transforming growth factor-β1. Ther Adv Respir Dis. 2021 Jan-Dec;15:1753466620981858. doi: 10.1177/1753466620981858. PMID: 33530899; PMCID: PMC7970683. |