Primary Information |
|---|
| BoMiProt ID | Bomi4470 |
|---|
| Protein Name | Carbonic anhydrase 3/Carbonate dehydratase III/Carbonic anhydrase III/CA-III |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SZX4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029609.1 |
|---|
| Aminoacid Length | 260 |
|---|
| Molecular Weight | 29370 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CA3 |
|---|
| Gene ID | 513212 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | metalloenzymes catalyze the reversible hydration of carbon dioxide and bicarbonate.The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. |
|---|
| Biochemical Properties | catalyses the rapid hydration and dehydration of CO2 and H2CO3, respectively, is widely distributed in mammalian tissues |
|---|
| Significance in milk | participates in physiological systems such as respiration, acid-base balance, ion transport, bone resorption, signal transduction, ureagenesis, gluconeogenesis, and lipogenesis. |
|---|
| PTMs | Acetylation on Ala, Glutathionylation on Cys, Phosphorylation on Ser ,Thr ,Tyr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZX4|CAH3_BOVIN Carbonic anhydrase 3 OS=Bos taurus OX=9913 GN=CA3 PE=2 SV=3
MAKEWGYADHNGPDHWHELFPNAKGENQS*29PIELNTKEISHDPS*43LKPWTAS*50YDPGS*55AKTIL
NNGKTCRVVFDDT*73YDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKY*127NSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPIT*216VSS*219DQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (1-29), disordered residues-36,44,237,260 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | S-glutathionylated in hepatocytes under oxidative stress |
|---|
| Additional Comments | Carbonic anhydrase III (CA III) exhibits low carbon dioxide hydratase activity in cancer. CA III promotes EMT and cell migration and is potentially related to the FAK/Src signaling pathway in oral cancer. |
|---|
| Linking IDs | |
|---|
| Bibliography | 1.Kitade K, Nishita T, Yamato M, Sakamoto K, Hagino A, Katoh K, Obara Y. Expression and localization of carbonic anhydrase in bovine mammary gland and secretion in milk. Comp Biochem Physiol A Mol Integr Physiol. 2003 Feb;134(2):349-54. doi: 10.1016/s1095-6433(02)00268-4. PMID: 12547264. 2.Chu YH, Su CW, Hsieh YS, Chen PN, Lin CW, Yang SF. Carbonic Anhydrase III Promotes Cell Migration and Epithelial-Mesenchymal Transition in Oral Squamous Cell Carcinoma. Cells. 2020 Mar 13;9(3):704. doi: 10.3390/cells9030704. PMID: 32183030; PMCID: PMC7140601. |