Primary Information |
|---|
| BoMiProt ID | Bomi4439 |
|---|
| Protein Name | Calumenin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0K1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029837.1 |
|---|
| Aminoacid Length | 315 |
|---|
| Molecular Weight | 37083 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CALU |
|---|
| Gene ID | 539218 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Calumenin protein (CP) is located within the endoplasmic reticulum Ca2+ binding proteins, and is important in ER-initiated apoptosis. |
|---|
| Biochemical Properties | Calumenin (mainly calumenin-1/-2) contains a N-terminal signal peptide (19 amino-acids) and multiple EF-hand domains. |
|---|
| PTMs | N6-acetylation at Lysine,N-Linked Glycosylation at Asn, Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0K1|CALU_BOVIN Calumenin OS=Bos taurus OX=9913 GN=CALU PE=2 SV=1
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQS*44FDY*47DHDAFLGAEEAKT
FDQLT*65PEES*69KERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDLNQ
DGLISWDEYRN*131VTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQEPMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEF
RDKNRDGKMDKEET*254KDWILPS*261DYDHAEAEARHLVYES*277DQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
|
|---|
| Predicted Disorder Regions | 23-38, 85-88, 104-129, 226-229 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Calumenin directly interacts with the forth luminal loop of SERCA2, and knockdown of calumenin significantly enhances cytosolic calcium transient amplitude and increases calcium sensitivity of SERCA2. |
|---|
| Bibliography | 1.Wang Y, Sun Y, Fu Y, Guo X, Long J, Xuan LY, Wei CX, Zhao M. Calumenin relieves cardiac injury by inhibiting ERS-initiated apoptosis during viral myocarditis. Int J Clin Exp Pathol. 2017 Jul 1;10(7):7277-7284. PMID: 31966567; PMCID: PMC6965232. 2. S.K. Sahoo, T. Kim, G.B. Kang, J.G. Lee, S.H. Eom, H. Kim do, Characterization of calumenin-SERCA2 interaction in mouse cardiac sarcoplasmic reticulum, J.Biol. Chem. 284 (2009) 31109–31121. 3.H. Vorum, H. Hager, B.M. Christensen, S. Nielsen, B. Honore, Human calumenin localizes to the secretory pathway and is secreted to the medium, Exp. Cell Res.248 (1999) 473–481. |