Primary Information |
|---|
| BoMiProt ID | Bomi4410 |
|---|
| Protein Name | Calcium/calmodulin-dependent protein kinase type II subunit delta |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2HJF7 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001039798.1 |
|---|
| Aminoacid Length | 488 |
|---|
| Molecular Weight | 55293 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CAMK2D |
|---|
| Gene ID | 532713 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | longissimus thoracis muscle |
|---|
| Protein Function | In the heart, Ca2+/calmodulin-dependent protein kinase II is critically involved in the regulation of Ca2+ homeostasis. |
|---|
| PTMs | N-acetylation at Ala,Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus OX=9913 GN=CAMK2D PE=2 SV=1
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQET*287VDCLKKFNARRKL
KGAILT*306T*307MLATRNFS*315AKS*318LLKKPDGVKKRKSSSSVQMMES*340T*341ES*343SNT*346T*347IEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALS*414KSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRS
GSPTVPIN
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | CaMKII delta(2) autophosphorylation may play an important role in PDGF-stimulated VSM cell migration. |
|---|
| Bibliography | 1.Pfleiderer PJ, Lu KK, Crow MT, Keller RS, Singer HA. Modulation of vascular smooth muscle cell migration by calcium/ calmodulin-dependent protein kinase II-delta 2. Am J Physiol Cell Physiol. 2004 Jun;286(6):C1238-45. doi: 10.1152/ajpcell.00536.2003. Epub 2004 Feb 4. PMID: 14761894. 2.Hagemann D, Hoch B, Krause EG, Karczewski P. Developmental changes in isoform expression of Ca2+/calmodulin-dependent protein kinase II delta-subunit in rat heart. J Cell Biochem. 1999 Aug 1;74(2):202-10. PMID: 10404390. |
|---|
