Primary Information |
|---|
| BoMiProt ID | Bomi4318 |
|---|
| Protein Name | BRISC and BRCA1-A complex member 1/Mediator of RAP80 interactions and targeting subunit of 40 kDa/New component of the BRCA1-A complex |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08E57 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001070269.1 |
|---|
| Aminoacid Length | 332 |
|---|
| Molecular Weight | 36886 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | BABAM1/MERIT40/NBA1 |
|---|
| Gene ID | 504517 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | The breast cancer associated gene 1 (BRCA1)-A protein complex assembles at DNA damage-induced nuclear foci to facilitate repair of double-stranded breaks. |
|---|
| Biochemical Properties | BRCA1 A complex bears striking similarities to the 19S proteasome complex. Furthermore, we show that four members of the BRCA1-A complex possess a polyubiquitin chain-binding capability, thus forming a complex that might facilitate the deubiquitinating activity of the deubiquitination enzyme BRCC36 or the E3 ligase activity of the BRCA1/BARD1 ligase. |
|---|
| PTMs | N-Linked Acetylation at Meth,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08E57|BABA1_BOVIN BRISC and BRCA1-A complex member 1 OS=Bos taurus OX=9913 GN=BABAM1 PE=2 SV=1
MEVAEPSCPTEEEEEEEEEEEQSAEPRPRTRS*32NPEGAEDRALGAQTSVGSRS*52EGEGEAAS*60ADDGTANPPGAGPKPWQVPPPAPEVQVRTPRVNCPEKVIICLDLSEEMALPKLESFNGSK
TNALNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETAS
CSTFNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQ
CPYFFFDVVYIHNGADEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAK
LLAHPLQRPCQSHASYSLLEEDDEATEVEATV
|
|---|
| Predicted Disorder Regions | 1-91, 318-332 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Additional Comments | NBA1 is a component of the BRCA1 A complex, which also contains Brca1/Bard1, Abra1, RAP80, BRCC36, and BRE. NBA1 is required to maintain BRE and Abra1 abundance and for the recruitment of BRCA1 to sites of DNA damage. |
|---|
| Bibliography | 1.Mok MT, Henderson BR. The in vivo dynamic organization of BRCA1-A complex proteins at DNA damage-induced nuclear foci. Traffic. 2012 Jun;13(6):800-14. doi: 10.1111/j.1600-0854.2012.01355.x. Epub 2012 Apr 8. PMID: 22420687. 2.Wang B, Hurov K, Hofmann K, Elledge SJ. NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control. Genes Dev. 2009 Mar 15;23(6):729-39. doi: 10.1101/gad.1770309. Epub 2009 Mar 4. PMID: 19261749; PMCID: PMC2661606. |