Primary Information |
---|
BoMiProt ID | Bomi4311 |
---|
Protein Name | Breast cancer metastasis-suppressor 1-like protein |
---|
Organism | Bos taurus |
---|
Uniprot ID | A4FV29 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001076897.1 |
---|
Aminoacid Length | 323 |
---|
Molecular Weight | 37629 |
---|
FASTA Sequence |
Download |
---|
Gene Name | BRMS1L |
---|
Gene ID | 514432 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | a component of Sin3A-histone deacetylase (HDAC) co-repressor complex,Involved in the histone deacetylase (HDAC1)-dependent transcriptional repression activity.suppress the transcriptional activity of FZD10 promoter. |
---|
PTMs | Isopeptide bond formation, Phosphorylation, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FV29|BRM1L_BOVIN Breast cancer metastasis-suppressor 1-like protein OS=Bos taurus OX=9913 GN=BRMS1L PE=2 SV=1
MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRME
CLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVA
GIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSE
LWNDELQSRKKRKDPFS*197PDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVK
TEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKR
PDGSKSKLYISQLQKGKYSIKHS
|
---|
Predicted Disorder Regions | 1-71, 96-107, 184-204, 234-254, 306-323 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | no TM helices |
---|
Significance of PTMs | serine residue immediately upstream of the critical metastasis suppressor domain of BRMS1L is found to be phosphorylated by Cyclin Dependent Kinase 2 (CDK2).Phosphorylation status at S237 regulates BRMS1 protein interactions related to a variety of biological processes, phenotypes [cell cycle (e.g., CDKN2A), DNA repair (e.g., BRCA1)], and metastasis [(e.g., TCF2 and POLE2)]. Presence of S237 also directly decreased MDA-MB-231 breast carcinoma migration in vitro and metastases in vivo. |
---|
Additional Comments | Ectopic expression of BRMS1L inhibited cancer cell invasion and migration; knockdown of BRMS1L by siRNA induced the opposite effect. reduced BRMS1L in breast cancer tissues is associated with metastasis and poor patient survival |
---|
Bibliography | 1.Zimmermann RC, Sardiu ME, Manton CA, Miah MS, Banks CAS, Adams MK, Koestler DC, Hurst DR, Edmonds MD, Washburn MP, Welch DR. Perturbation of BRMS1 interactome reveals pathways that impact metastasis. PLoS One. 2021 Nov 17;16(11):e0259128. doi: 10.1371/journal.pone.0259128. PMID: 34788285; PMCID: PMC8598058. |