Primary Information |
|---|
| BoMiProt ID | Bomi4273 |
|---|
| Protein Name | Beta-synuclein/14 kDa brain-specific protein/Phosphoneuroprotein 14/PNP 14 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P33567 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 134 |
|---|
| Molecular Weight | 14277 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SNCB |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Soluble proteins in presynaptic terminals.Role in neuronal plasticity.an enzyme that catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and appears to play a role in cytoskeletal reorganization and/or endocytosis at the plasma membrane . |
|---|
| Biochemical Properties | it is β-synuclein 134 aa long.α-Synuclein, β-synuclein and γ-synuclein range from 127 to 140 amino acids in length, and are 55–62% identical in sequence, with a similar domain organization.Provided with the consensus sequence KTKEGV. This positively charged region is followed by a hydrophobic middle part and a negatively charged carboxy-terminal region.Elongated helix structure.The elongated helix structure is not truly alpha-helical (3.6 amino acids per turn) but rather an α-11/3 helix, in which there are 3.67 amino acids per turn. |
|---|
| PTMs | Phosphorylation by G-protein coupled receptor kinases (GRK),CK1, CK2 and CaM-kinase II. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P33567|SYUB_BOVIN Beta-synuclein OS=Bos taurus OX=9913 GN=SNCB PE=1 SV=1
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTK
EQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGES*118YE
EQPQEEYQEYEPEA
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (1-134) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Beta-synuclein in cerebrospinal fluid as an early diagnostic marker of Alzheimer's disease |
|---|
| Bibliography | George JM. The synucleins. Genome Biol. 2002;3(1):REVIEWS3002. doi: 10.1186/gb-2001-3-1-reviews3002. Epub 2001 Dec 20. PMID: 11806835; PMCID: PMC150459. |
|---|
