Primary Information |
|---|
| BoMiProt ID | Bomi4216 |
|---|
| Protein Name | Barrier-to-autointegration factor |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P61283 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_892033.1 |
|---|
| Aminoacid Length | 89 |
|---|
| Molecular Weight | 10059 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | BANF1 |
|---|
| Gene ID | 360196 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | vertebral column |
|---|
| Protein Function | Barrier-to-Autointegration Factor (BAF), a DNA-binding protein involved in post-mitotic NE reformation and cytosolic viral regulation, as an essential protein for nuclear rupture repair. |
|---|
| Biochemical Properties | BAF forms obligate dimers, with each monomer binding to dsDNA (hereafter referred to simply as DNA) in a sequence-independent manner, allowing for the looping and condensation of DNA through intramolecular cross-bridging. Along with DNA, BAF also binds to the LAP2-Emerin-MAN1 (LEM) domain, a motif found in a family of proteins known collectively as the LEM-domain proteins of the INM, ER, and nucleoplasm. |
|---|
| PTMs | N-acetylation at Meth,Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P61283|BAF_BOVIN Barrier-to-autointegration factor OS=Bos taurus OX=9913 GN=BANF1 PE=3 SV=1
MT*2T*3S*4QKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTCGANAKQSRDCFGCLREWCDAFL
|
|---|
| Predicted Disorder Regions | (1-20) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation on Thr-2; Thr-3 and Ser-4 disrupts its ability to bind DNA and reduces its ability to bind LEM domain-containing proteins. |
|---|
| Bibliography | 1.Halfmann CT, Roux KJ. Barrier-to-autointegration factor: a first responder for repair of nuclear ruptures. Cell Cycle. 2021 Apr;20(7):647-660. doi: 10.1080/15384101.2021.1892320. Epub 2021 Mar 8. PMID: 33678126; PMCID: PMC8078722. 2.Skoko D, Li M, Huang Y, et al. Barrier-to-autointegration factor (BAF) condenses DNA by looping. Proc Natl Acad Sci U S A. 2009;106:16610–16615. 3.Lee KK, Haraguchi T, Lee RS, et al. Distinct functional domains in emerin bind lamin A and DNA-bridging protein BAF. J Cell Sci. 2001;114:4567–4573. |
|---|
