Primary Information |
|---|
| BoMiProt ID | Bomi4042 |
|---|
| Protein Name | Arylacetamide deacetylase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0P5B7 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069259.1 |
|---|
| Aminoacid Length | 399 |
|---|
| Molecular Weight | 45604 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | AADAC |
|---|
| Gene ID | 519557 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Human arylacetamide deacetylase (AADAC) plays a role in the detoxification or activation of drugs and is sometimes involved in the incidence of toxicity by catalyzing hydrolysis reactions. |
|---|
| Biochemical Properties | Human arylacetamide deacetylase (AADAC) is a single microsomal serine esterase involved in the hydrolysis of many acetyl-containing drugs. |
|---|
| PTMs | Disulphide bond formation and N-Linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0P5B7|AAAD_BOVIN Arylacetamide deacetylase OS=Bos taurus OX=9913 GN=AADAC PE=2 SV=1
MRKKYFGFLILGVLLAGYIYVPLPDNVEEPWKIMLLNTFLKTSSYLALFGEILGLNHFMK
SMALFSRIQGFPPTSDENIIVKDTTFNDIPVRIYVPQQKTKSLRRGLFYIHGGGWCFGSN
DYYSYDLLSRWTAERLDAVVISTNYRLAPKYHFPVQFEDVYTALKWFLDPQNLESYGVDP
GRIGISGDSAGGNLAAAVAQQLLEDPDVKIKLKVQTLIYPALQNFDFDLPSYRENAHYPV
LSKSLMVRFWSEYFTTDRSLKKAMLSNQHIPLESSNLFKFVN*282WSSLLPEKFKKGHIYKTP
THGSSELAKKYPGILDVKASPLLADDSKLRGLPLTYVITCQYDVLRDDGLMYVTRLQKSG
VQVIHNHVEGAFHGTLAFLFTKVGYRAANQYINWLHENL
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (5-23) |
|---|
| Additional Comments | Prasugrel, a thienopyridine anti-platelet agent, is pharmacologically activated by hydrolysis and hydroxylation.AADAC largely contributes to prasugrel hydrolysis in both human and dog intestine. |
|---|
| Bibliography | 1.Gabriele M, Puccini P, Lucchi M, Aprile V, Gervasi PG, Longo V. Arylacetamide Deacetylase Enzyme: Presence and Interindividual Variability in Human Lungs. Drug Metab Dispos. 2019 Sep;47(9):961-965. doi: 10.1124/dmd.119.087031. Epub 2019 Jun 24. PMID: 31235486. 2.Kurokawa T, Fukami T, Yoshida T, Nakajima M. Arylacetamide Deacetylase is Responsible for Activation of Prasugrel in Human and Dog. Drug Metab Dispos. 2016 Mar;44(3):409-16. doi: 10.1124/dmd.115.068221. Epub 2015 Dec 30. PMID: 26718653. |
|---|
