Primary Information |
|---|
| BoMiProt ID | Bomi4016 |
|---|
| Protein Name | ARL14 effector protein/ARF7 effector protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EA92 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001026931.2 |
|---|
| Aminoacid Length | 5.Xu Y, Liu Y, Guo H, Ding W. Apoptosis-Associated Speck-Like Protein Containing a CARD Deletion Ame |
|---|
| Molecular Weight | 29209 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ARL14EP/ARF7EP |
|---|
| Gene ID | 523894 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | ARL14/ARF7, is a GTPase that is selectively expressed in immune cells.RL14/ARF7-ARF7EP acts as a MYO1E receptor on MHC-II compartments for actin-based transport control. |
|---|
| Biochemical Properties | Vvarious proteins are there controlling MHC-II transport in DCs. One of these, the GTPase ARL14/ARF7, detected on MHC-II vesicles in imDCs (Figure 7A) and selected as a starting point for building a pathway aimed at understanding the molecular basis of MHC-II transport in DCs. Guanine exchange factors (GEFs) activating ARF GTPases are specified by SEC7 domains. |
|---|
| PTMs | Acetylation at Meth, Isopeptide bond formation, Phosphorylation at Ser,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA92|AL14E_BOVIN ARL14 effector protein OS=Bos taurus OX=9913 GN=ARL14EP PE=2 SV=1
MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHH
AKVYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCT
QIINGSVDVDSEDRQKRKPDSDGRTAKALRSLQFANPGKQTEFAPETGKREKRRLTKNAT
AGS*183DRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRK
WLYEQIEIEGGEIIHNKHAG
|
|---|
| Predicted Disorder Regions | 130-186, 256-260 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | MHC-II transport was controlled by the GTPase ARL14/ARF7, which recruits the motor myosin 1E via an effector protein ARF7EP. This complex controls movement of MHC-II vesicles along the actin cytoskeleton in human dendritic cells (DCs). |
|---|
| Bibliography | 1.Vascotto, F., Lankar, D., Faure-Andre´ , G., Vargas, P., Diaz, J., Le Roux, D., Yuseff, M.I., Sibarita, J.B., Boes, M., Raposo, G., et al. (2007). The actin-based motor protein myosin II regulates MHC class II trafficking and BCR-driven antigen presentation. J. Cell Biol. 176, 1007–1019. 2.Petra Paul; Tineke van den Hoorn; Marlieke L.M. Jongsma; Mark J. Bakker; Rutger Hengeveld; Lennert Janssen; Peter Cresswell; David A. Egan; Marieke van Ham; Anja ten Brinke; Huib Ovaa; Roderick L. Beijersbergen; Coenraad Kuijl; Jacques Neefjes (2011). A Genome-wide Multidimensional RNAi Screen Reveals Pathways Controlling MHC Class II Antigen Presentation. , 145(2), 0–283. doi:10.1016/j.cell.2011.03.023 |