Primary Information |
|---|
| BoMiProt ID | Bomi3983 |
|---|
| Protein Name | Arfaptin-2/ADP-ribosylation factor-interacting protein 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZCL5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029649.1 |
|---|
| Aminoacid Length | 341 |
|---|
| Molecular Weight | 37711 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ARFIP2 |
|---|
| Gene ID | 514938 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | involved in Golgi function along with ARF1.Arfaptin 2/POR1 has been shown to interact with the Ras-related GTPases ARF6 and Rac1, and may regulate cytoskeletal remodelling mediated by these GTPases |
|---|
| PTMs | phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZCL5|ARFP2_BOVIN Arfaptin-2 OS=Bos taurus OX=9913 GN=ARFIP2 PE=2 SV=1
MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPS*72HSAT*76PAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
|
|---|
| Predicted Disorder Regions | 1-89, 247-260, 327-341 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Akt phosphorylated arfaptin 2 at Ser(260).As a result of this phosphorylated protein inhibits polyQ-huntingtin-induced neurotoxicity. Lack of phosphorylation of arfaptin 2 at this site substantially modified its subcellular distribution and increased neuronal death and intranuclear inclusions caused by polyQ-huntingtin. |
|---|
| Bibliography | 1.Peters PJ, Ning K, Palacios F, Boshans RL, Kazantsev A, Thompson LM, Woodman B, Bates GP, D'Souza-Schorey C. Arfaptin 2 regulates the aggregation of mutant huntingtin protein. Nat Cell Biol. 2002 Mar;4(3):240-5. doi: 10.1038/ncb761. PMID: 11854752. 2.Rangone H, Pardo R, Colin E, Girault JA, Saudou F, Humbert S. Phosphorylation of arfaptin 2 at Ser260 by Akt Inhibits PolyQ-huntingtin-induced toxicity by rescuing proteasome impairment. J Biol Chem. 2005 Jun 10;280(23):22021-8. doi: 10.1074/jbc.M407528200. Epub 2005 Apr 4. PMID: 15809304. |