Primary Information |
---|
BoMiProt ID | Bomi3976 |
---|
Protein Name | Apoptosis regulator Bcl-2 |
---|
Organism | Bos taurus |
---|
Uniprot ID | O02718 |
---|
Milk Fraction | Whey |
---|
Aminoacid Length | 229 |
---|
Molecular Weight | 25100 |
---|
FASTA Sequence |
Download |
---|
Gene Name | BCL2 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | Inhibition of apoptosis.Regulates cell death by controlling the mitochondrial membrane permeability.Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). |
---|
Significance in milk | Control proliferation of bovine mammary epithelial cells,shows antiapoptotic effect during heat stress in summer |
---|
PTMs | Phosphorylation on Ser and Thr |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|O02718|BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS
RT*62S*63PPPPPAAAAGPAPS*77PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ
DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
|
---|
Predicted Disorder Regions | 2 disordered segments; (1-12), (26-83) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH;(204-226) |
---|
Significance of PTMs | Phosphorylation/dephosphorylation on Ser-63 regulates anti-apoptotic activity.Phosphorylation on Ser-63 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle.three residues (Ser70, Ser87, and Thr69) within the unstructured loop of BCL-2 that are phosphorylated in response to microtubule-damaging agents, which also arrest cells at G(2)/M.Stress response kinases phosphorylate BCL-2 during cell cycle progression as a normal physiologic process to inactivate BCL-2 at G(2)/M. |
---|
Bibliography | Yamamoto K, Ichijo H, Korsmeyer SJ. BCL-2 is phosphorylated and inactivated by an ASK1/Jun N-terminal protein kinase pathway normally activated at G(2)/M. Mol Cell Biol. 1999 Dec;19(12):8469-78. doi: 10.1128/MCB.19.12.8469. PMID: 10567572; PMCID: PMC84954. |