Primary Information |
|---|
| BoMiProt ID | Bomi3973 |
|---|
| Protein Name | Apolipoprotein D/ApoD/Apo-D |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32KY0 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001069769.1 |
|---|
| Aminoacid Length | 189 |
|---|
| Molecular Weight | 21402 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | APOD |
|---|
| Gene ID | 613972 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | ApoD levels rise considerably in association with aging and neuropathologies such as Alzheimer's disease, stroke, meningoencephalitis, moto-neuron disease, multiple sclerosis, schizophrenia and Parkinson's disease. |
|---|
| Biochemical Properties | ApoD does not share significant degrees of homology in amino acid sequence with other apolipoproteins. Instead, apoD is structurally similar to lipocalins, a diverse family of lipid-binding proteins that are responsible for transporting lipids and other small hydrophobic molecules for metabolism. |
|---|
| PTMs | Disulfide bond formation, N-Linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32KY0|APOD_BOVIN Apolipoprotein D OS=Bos taurus OX=9913 GN=APOD PE=2 SV=1
MVPVLLLLPALAGLFGAAEGQAFHLGKCPHPPVQENFDVNKYLGKWYEIEKIPVSFEKGS
CIQAN*65YSLKENGNVEVINKELRADGTVNQIEGEATPEN*98ITEPAKLAVKFFWFMPSAPYWV
LATDYENYALVYSCTTIIWLFHMDHVWILGRNPYLPPETVTYLKDILTSNNIEVEKMTIT
DQVNCPESM
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | The molecular weight of mature human ApoD is 19 kDa. It consists of 169 amino acids with glycosylation sites at residues 45 and 178, corresponding to asparagine.The glycosylation pattern of ApoD varies depending on the site; these values correspond to plasma ApoD, where carbohydrates are less complex and extensive and glycosylation is therefore smaller than ApoD in other body secretions and tissues |
|---|
| Additional Comments | ApoD is associated with anti-oxidation and anti-stress activities, contributing to lifespan expansion in fruit flies. ApoD dysregulation contributes to the pathogenesis of dyslipidemia and atherosclerosis. |
|---|
| Bibliography | 1.Rassart E, Desmarais F, Najyb O, Bergeron KF, Mounier C. Apolipoprotein D. Gene. 2020 Sep 25;756:144874. doi: 10.1016/j.gene.2020.144874. Epub 2020 Jun 15. PMID: 32554047; PMCID: PMC8011330. 2.Rassart E, Desmarais F, Najyb O, Bergeron KF, Mounier C. Apolipoprotein D. Gene. 2020 Sep 25;756:144874. doi: 10.1016/j.gene.2020.144874. Epub 2020 Jun 15. PMID: 32554047; PMCID: PMC8011330. 3.Navarro-Incio AM, Tolivia-Fernandez J. The involvement of apolipoprotein D in pathologies affecting the nervous system. Rev Neurol. 2004; 38(12), 1166–75. |
|---|
