Search by BoMiProt ID - Bomi3973


Primary Information

BoMiProt ID Bomi3973
Protein Name Apolipoprotein D/ApoD/Apo-D
Organism Bos taurus
Uniprot IDQ32KY0
Milk FractionWhey,MFGM
Ref Sequence ID NP_001069769.1
Aminoacid Length 189
Molecular Weight 21402
FASTA Sequence Download
Gene Name APOD
Gene ID 613972
Protein Existence Status reviewed

Secondary Information

Protein Function ApoD levels rise considerably in association with aging and neuropathologies such as Alzheimer's disease, stroke, meningoencephalitis, moto-neuron disease, multiple sclerosis, schizophrenia and Parkinson's disease.
Biochemical Properties ApoD does not share significant degrees of homology in amino acid sequence with other apolipoproteins. Instead, apoD is structurally similar to lipocalins, a diverse family of lipid-binding proteins that are responsible for transporting lipids and other small hydrophobic molecules for metabolism. 
PTMs Disulfide bond formation, N-Linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32KY0|APOD_BOVIN Apolipoprotein D OS=Bos taurus OX=9913 GN=APOD PE=2 SV=1 MVPVLLLLPALAGLFGAAEGQAFHLGKCPHPPVQENFDVNKYLGKWYEIEKIPVSFEKGS CIQAN*65YSLKENGNVEVINKELRADGTVNQIEGEATPEN*98ITEPAKLAVKFFWFMPSAPYWV LATDYENYALVYSCTTIIWLFHMDHVWILGRNPYLPPETVTYLKDILTSNNIEVEKMTIT DQVNCPESM
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The molecular weight of mature human ApoD is 19 kDa. It consists of 169 amino acids with glycosylation sites at residues 45 and 178, corresponding to asparagine.The glycosylation pattern of ApoD varies depending on the site; these values correspond to plasma ApoD, where carbohydrates are less complex and extensive and glycosylation is therefore smaller than ApoD in other body secretions and tissues
Additional Comments ApoD is associated with anti-oxidation and anti-stress activities, contributing to lifespan expansion in fruit flies. ApoD dysregulation contributes to the pathogenesis of dyslipidemia and atherosclerosis.
Bibliography 1.Rassart E, Desmarais F, Najyb O, Bergeron KF, Mounier C. Apolipoprotein D. Gene. 2020 Sep 25;756:144874. doi: 10.1016/j.gene.2020.144874. Epub 2020 Jun 15. PMID: 32554047; PMCID: PMC8011330. 2.Rassart E, Desmarais F, Najyb O, Bergeron KF, Mounier C. Apolipoprotein D. Gene. 2020 Sep 25;756:144874. doi: 10.1016/j.gene.2020.144874. Epub 2020 Jun 15. PMID: 32554047; PMCID: PMC8011330. 3.Navarro-Incio AM, Tolivia-Fernandez J. The involvement of apolipoprotein D in pathologies affecting the nervous system. Rev Neurol. 2004; 38(12), 1166–75.