Primary Information |
---|
BoMiProt ID | Bomi3928 |
---|
Protein Name | Ankyrin repeat domain-containing protein 54 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q1LZC5 |
---|
Milk Fraction | whey |
---|
Ref Sequence ID | NP_001069605.1 |
---|
Aminoacid Length | 299 |
---|
Molecular Weight | 32466 |
---|
FASTA Sequence |
Download |
---|
Gene Name | ANKRD54 |
---|
Gene ID | 538961 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | Ankyrin repeat domain-containing protein 54 plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation. |
---|
Biochemical Properties | a novel nuclear-cytoplasmic (containing functional NLS and NES motifs) shuttling adaptor of the Src family tyrosine kinase Lyn and other signalling molecules (e.g., HCLS1), that regulates down-stream signalling in erythropoietin-responsive erythroid cells[ |
---|
PTMs | Acetylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus OX=9913 GN=ANKRD54 PE=2 SV=1
MAAAAGGADDESRSGRSSSDGECAVAPEPLTGPEGLFSFADFGSALGGGAGLPGRAS*57GGA
QS*62PLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANAN
DVETVQQLLEEGTDPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLH
LAACTNHAPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQI
IQMLREYLERLGRHEQRERLDDLCTRLQKTSTREQVDEVTDLLASFTSLSLQMQNMEKR
|
---|
Predicted Disorder Regions | 1-58, 100-105 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | phosphorylation by PKCδ as a major regulator of nuclear-cytoplasmic shuttling of Ankrd54.Activation of PKC kinases promoted nuclear export and phosphorylation of Ankrd54, and increased interaction and cytoplasmic co-localization with Lyn. Co-expression of an active form of the PKCδ isoform specifically promoted both phosphorylation and cytoplasmic localization of Ankrd54. Alanine mutation of several serine residues in the amino-terminal region of Ankrd54 reduced both phorbol 12-myristate 13-acetate induced cytoplasmic localization and phosphorylation of Ankrd54.PKCδ as a major regulator of nuclear-cytoplasmic shuttling and interaction of Ankrd54 with Lyn, through its phosphorylation of at least the Ser18 residue. |
---|
Bibliography | 1.Samuels AL, Louw A, Zareie R, Ingley E. Control of nuclear-cytoplasmic shuttling of Ankrd54 by PKCδ. World J Biol Chem. 2017 Aug 26;8(3):163-174. doi: 10.4331/wjbc.v8.i3.163. PMID: 28924458; PMCID: PMC5579962. 2.Samuels, A. L., Louw, A., Zareie, R., & Ingley, E. (2017). Control of nuclear-cytoplasmic shuttling of Ankrd54 by PKCδ. World journal of biological chemistry, 8(3), 163–174. https://doi.org/10.4331/wjbc.v8.i3.163 |