Primary Information |
|---|
| BoMiProt ID | Bomi3876 |
|---|
| Protein Name | Angio-associated migratory cell protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3SZK1 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001070463.1 |
|---|
| Aminoacid Length | 434 |
|---|
| Molecular Weight | 46829 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | AAMP |
|---|
| Gene ID | 767919 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | retina |
|---|
| Protein Function | Angio-associated migratory cell protein (AAMP) is considered a pro-tumor protein, which contributes to angiogenesis, proliferation, adhesion, and other biological activities. |
|---|
| Biochemical Properties | It is predicted to have two immunoglobulin-like 319 domains, a heparin binding consensus sequence, and a repeat WD40 motif. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZK1|AAMP_BOVIN Angio-associated migratory cell protein OS=Bos taurus OX=9913 GN=AAMP PE=2 SV=1
MESESESGAAADTPPLETLS*20FHGDEEIIEVVELDPGPPDPDDLVQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPTGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWDLKQGNSIHVLKGTEGHQGPLTCVATNQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLSTQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVFCVQRPDR
|
|---|
| Predicted Disorder Regions | 1-80, 305-318 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | AAMP overexpression suppressed the interaction between CDC42 and ARHGAP1. |
|---|
| Bibliography | 1.Yao S, Shi F, Mu N, Li X, Ma G, Wang Y, Sun X, Liu X, Su L. Angio-associated migratory cell protein (AAMP) interacts with cell division cycle 42 (CDC42) and enhances migration and invasion in human non-small cell lung cancer cells. Cancer Lett. 2021 Apr 1;502:1-8. doi: 10.1016/j.canlet.2020.11.050. Epub 2020 Dec 3. PMID: 33279622. 2.L. Yu, C. Gaitatzes, E. Neer, T.F. Smith, Thirty-plus functional families from a single motif, Protein Sci. 9 (2000) 2470-2476. 3.C. Zhang, F. Zhang, The Multifunctions of WD40 Proteins in Genome Integrity and Cell Cycle Progression, J. Genomics 3 (2015) 40-50. |
|---|
