Primary Information |
---|
BoMiProt ID | Bomi3876 |
---|
Protein Name | Angio-associated migratory cell protein |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3SZK1 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001070463.1 |
---|
Aminoacid Length | 434 |
---|
Molecular Weight | 46829 |
---|
FASTA Sequence |
Download |
---|
Gene Name | AAMP |
---|
Gene ID | 767919 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | retina |
---|
Protein Function | Angio-associated migratory cell protein (AAMP) is considered a pro-tumor protein, which contributes to angiogenesis, proliferation, adhesion, and other biological activities. |
---|
Biochemical Properties | It is predicted to have two immunoglobulin-like 319 domains, a heparin binding consensus sequence, and a repeat WD40 motif. |
---|
PTMs | Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3SZK1|AAMP_BOVIN Angio-associated migratory cell protein OS=Bos taurus OX=9913 GN=AAMP PE=2 SV=1
MESESESGAAADTPPLETLS*20FHGDEEIIEVVELDPGPPDPDDLVQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPTGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWDLKQGNSIHVLKGTEGHQGPLTCVATNQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLSTQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVFCVQRPDR
|
---|
Predicted Disorder Regions | 1-80, 305-318 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | AAMP overexpression suppressed the interaction between CDC42 and ARHGAP1. |
---|
Bibliography | 1.Yao S, Shi F, Mu N, Li X, Ma G, Wang Y, Sun X, Liu X, Su L. Angio-associated migratory cell protein (AAMP) interacts with cell division cycle 42 (CDC42) and enhances migration and invasion in human non-small cell lung cancer cells. Cancer Lett. 2021 Apr 1;502:1-8. doi: 10.1016/j.canlet.2020.11.050. Epub 2020 Dec 3. PMID: 33279622. 2.L. Yu, C. Gaitatzes, E. Neer, T.F. Smith, Thirty-plus functional families from a single motif, Protein Sci. 9 (2000) 2470-2476. 3.C. Zhang, F. Zhang, The Multifunctions of WD40 Proteins in Genome Integrity and Cell Cycle Progression, J. Genomics 3 (2015) 40-50. |