Primary Information |
|---|
| BoMiProt ID | Bomi3869 |
|---|
| Protein Name | Anamorsin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EAC7 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001015659.1 |
|---|
| Aminoacid Length | 310 |
|---|
| Molecular Weight | 33205 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CIAPIN1 |
|---|
| Gene ID | 535119 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | spermatocyte |
|---|
| Protein Function | Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis.Anamorsin is reported to be involved in the development of multidrug resistance in leukemia cells and to be associated with increased tumor recurrence, making anti-anamorsin therapy a new cancer treatment strategy. |
|---|
| PTMs | Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EAC7|CPIN1_BOVIN Anamorsin OS=Bos taurus OX=9913 GN=CIAPIN1 PE=2 SV=1
MADFGISAGQFVAVIWDKSSPVEALKDLVDKLQALTGDEGRVSVENINQLLQSAHKESSF
DIVLSGIIPGSTTLHSADILAEMARILRPGGCLFLKEPVETAVVNNSKVKTASKLCSALT
LSGLVEVKELQRESLSPEEIQSVREHLGYHSDSLLSLQITGKKPNFEVGSSSQLKLS*177IAK
KS*182S*183GKPAVDPAAAKLWTLSANDMEDESVDLIDS*213DELLDAEDLKKPDPASLRAPSCGEGKK
RKACKNCTCGLAEELEKEKSRDQISSQPKS*270ACGNCYLGDAFRCASCPYLGMPAFKPGEKV
LLS*303DS*305NLHDA
|
|---|
| Predicted Disorder Regions | 129-151, 171-208, 220-243, 263-266, 307-310 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Z. Hao, X. Li, T. Qiao, J. Zhang, X. Shao, D. Fan.Distribution of CIAPIN1 in normal fetal and adult human tissues.J. Histochem. Cytochem., 54 (2006), pp. 417-426. 2.X. Li, K. Wu, D. Fan.CIAPIN1 as a therapeutic target in cancer.Expert Opin. Ther. Targets, 14 (2010), pp. 603-610. |
|---|
