Primary Information |
|---|
| BoMiProt ID | Bomi3847 |
|---|
| Protein Name | Alpha-synuclein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0G8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029213.1 |
|---|
| Aminoacid Length | 140 |
|---|
| Molecular Weight | 14508 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | SNCA |
|---|
| Gene ID | 282857 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | Abundant in axon terminals of presynaptic neurons. |
|---|
| Protein Function | highly enriched in presynaptic nerve terminals.synaptic vesicle trafficking and subsequent neurotransmitter release. |
|---|
| Biochemical Properties | The central half of the alpha-synuclein polypeptide, containing five tandem repeats as well as a part of the carboxyl-terminal acidic region, forms the core structure of alpha-synuclein filaments, which is coated by the amino- and carboxyl-terminal portions at the periphery. |
|---|
| PTMs | Phosphorylated.Ubiquitinated.Acetylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0G8|SYUA_BOVIN Alpha-synuclein OS=Bos taurus OX=9913 GN=SNCA PE=2 SV=1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGRTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVTNVGEAVVTGVTAVAQKTVEGAGIAAATGFGKKDHMGKGEEGASQEGILEDMPVDP
DNEAEMPEEGYQDYEPEA
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (1-140) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylated on Tyr-125 upon osmotic stress.Acetylation at Met-1 for proper folding and native oligomeric structure. |
|---|
| Additional Comments | Accumulation of misfolded oligomers and larger aggregates of α-synuclein defines multiple neurodegenerative diseases called synucleinopathies |
|---|
| Bibliography | Burré J, Sharma M, Südhof TC. Cell Biology and Pathophysiology of α-Synuclein. Cold Spring Harb Perspect Med. 2018 Mar 1;8(3):a024091. doi: 10.1101/cshperspect.a024091. PMID: 28108534; PMCID: PMC5519445. |
|---|
